LSM4 Antibody - #DF13133
Product: | LSM4 Antibody |
Catalog: | DF13133 |
Description: | Rabbit polyclonal antibody to LSM4 |
Application: | WB |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Dog, Chicken, Xenopus |
Mol.Wt.: | 15 kDa; 15kD(Calculated). |
Uniprot: | Q9Y4Z0 |
RRID: | AB_2846093 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13133, RRID:AB_2846093.
Fold/Unfold
Glycine rich protein; GRP; LSM 4; LSM4 homolog; LSM4 homolog U6 small nuclear RNA associated (S. cerevisiae); LSM4 homolog U6 small nuclear RNA associated; U6 small nuclear RNA associated; U6 snRNA associated Sm like protein 4; U6 snRNA associated Sm like protein; U6 snRNA associated Sm like protein LSm 4; U6 snRNA associated Sm like protein LSm4; YER 112W; YER112W;
Immunogens
- Q9Y4Z0 LSM4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVKEEVVAKGRGRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGKQ
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9Y4Z0 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K52 | Ubiquitination | Uniprot | |
C59 | S-Nitrosylation | Uniprot | |
R62 | Methylation | Uniprot | |
K67 | Ubiquitination | Uniprot | |
K80 | Ubiquitination | Uniprot | |
R88 | Methylation | Uniprot | |
R90 | Methylation | Uniprot | |
R102 | Methylation | Uniprot | |
R109 | Methylation | Uniprot | |
R115 | Methylation | Uniprot | |
R117 | Methylation | Uniprot | |
R125 | Methylation | Uniprot | |
K138 | Acetylation | Uniprot |
Research Backgrounds
Plays role in pre-mRNA splicing as component of the U4/U6-U5 tri-snRNP complex that is involved in spliceosome assembly, and as component of the precatalytic spliceosome (spliceosome B complex). The heptameric LSM2-8 complex binds specifically to the 3'-terminal U-tract of U6 snRNA.
Nucleus.
Component of the precatalytic spliceosome (spliceosome B complex). Component of the U4/U6-U5 tri-snRNP complex, a building block of the precatalytic spliceosome (spliceosome B complex). The U4/U6-U5 tri-snRNP complex is composed of the U4, U6 and U5 snRNAs and at least PRPF3, PRPF4, PRPF6, PRPF8, PRPF31, SNRNP200, TXNL4A, SNRNP40, SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF, SNRPG, DDX23, CD2BP2, PPIH, SNU13, EFTUD2, SART1 and USP39, plus LSM2, LSM3, LSM4, LSM5, LSM6, LSM7 and LSM8. LSM2, LSM3, LSM4, LSM5, LSM6, LSM7 and LSM8 form a heptameric, ring-shaped subcomplex (the LSM2-8 complex) that is part of the U4/U6-U5 tri-snRNP complex and the precatalytic spliceosome.
Belongs to the snRNP Sm proteins family.
Research Fields
· Genetic Information Processing > Folding, sorting and degradation > RNA degradation.
· Genetic Information Processing > Transcription > Spliceosome.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.