KLF6 Antibody - #DF13114
![](/images/pubmed.gif)
Product: | KLF6 Antibody |
Catalog: | DF13114 |
Description: | Rabbit polyclonal antibody to KLF6 |
Application: | WB |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Sheep, Rabbit, Dog |
Mol.Wt.: | 43 kDa; 32kD(Calculated). |
Uniprot: | Q99612 |
RRID: | AB_2846074 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13114, RRID:AB_2846074.
Immunogens
Highly expressed in placenta followed by spleen, thymus, prostate, testis, small intestine and colon. Weakly expressed in pancreas, lung, liver, heart and skeletal muscle. Also expressed in fetal brain, spleen and thymus.
- Q99612 KLF6_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDVLPMCSIFQELQIVHETGYFSALPSLEEYWQQTCLELERYLQSEPCYVSASEIKFDSQEDLWTKIILAREKKEESELKISSSPPEDTLISPSFCYNLETNSLNSDVSSESSDSSEELSPTAKFTSDPIGEVLVSSGKLSSSVTSTPPSSPELSREPSQLWGCVPGELPSPGKVRSGTSGKPGDKGNGDASPDGRRRVHRCHFNGCRKVYTKSSHLKAHQRTHTGEKPYRCSWEGCEWRFARSDELTRHFRKHTGAKPFKCSHCDRCFSRSDHLALHMKRHL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q99612 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K66 | Ubiquitination | Uniprot | |
T147 | Phosphorylation | Uniprot | |
S150 | Phosphorylation | Uniprot | |
S151 | Phosphorylation | Uniprot | |
S171 | Phosphorylation | Uniprot | |
S192 | Phosphorylation | Uniprot | |
K209 | Acetylation | Uniprot | |
K213 | Acetylation | Uniprot | |
K218 | Acetylation | Uniprot | |
T223 | Phosphorylation | Uniprot | |
T225 | Phosphorylation | Uniprot | |
K228 | Acetylation | Uniprot | |
S233 | Phosphorylation | Uniprot |
Research Backgrounds
Transcriptional activator (By similarity). Binds a GC box motif. Could play a role in B-cell growth and development.
Nucleus.
Highly expressed in placenta followed by spleen, thymus, prostate, testis, small intestine and colon. Weakly expressed in pancreas, lung, liver, heart and skeletal muscle. Also expressed in fetal brain, spleen and thymus.
The acidic N-terminal part may favor interaction with the basic domain of transcription factors.
The 9aaTAD motif is a transactivation domain present in a large number of yeast and animal transcription factors. In KLF6, the motif is inactive.
Belongs to the krueppel C2H2-type zinc-finger protein family.
References
Application: WB Species: human Sample: glomerular mesangial cell
Application: WB Species: Human Sample: hNECs
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.