INTS9 Antibody - #DF13094
Product: | INTS9 Antibody |
Catalog: | DF13094 |
Description: | Rabbit polyclonal antibody to INTS9 |
Application: | WB |
Reactivity: | Human |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 74 kDa; 74kD(Calculated). |
Uniprot: | Q9NV88 |
RRID: | AB_2846054 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13094, RRID:AB_2846054.
Fold/Unfold
CPSF; CPSF2; CPSF2L; FLJ10871; Int9; INT9_HUMAN; Integrator complex subunit 9; INTS 9; INTS9; Protein related to CPSF subunits of 74 kDa; RC 74; RC-74; RC74; Related to CPSF subunits 74 kDa;
Immunogens
- Q9NV88 INT9_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKLYCLSGHPTLPCNVLKFKSTTIMLDCGLDMTSTLNFLPLPLVQSPRLSNLPGWSLKDGNAFLDKELKECSGHVFVDSVPEFCLPETELIDLSTVDVILISNYHCMMALPYITEHTGFTGTVYATEPTVQIGRLLMEELVNFIERVPKAQSASLWKNKDIQRLLPSPLKDAVEVSTWRRCYTMQEVNSALSKIQLVGYSQKIELFGAVQVTPLSSGYALGSSNWIIQSHYEKVSYVSGSSLLTTHPQPMDQASLKNSDVLVLTGLTQIPTANPDGMVGEFCSNLALTVRNGGNVLVPCYPSGVIYDLLECLYQYIDSAGLSSVPLYFISPVANSSLEFSQIFAEWLCHNKQSKVYLPEPPFPHAELIQTNKLKHYPSIHGDFSNDFRQPCVVFTGHPSLRFGDVVHFMELWGKSSLNTVIFTEPDFSYLEALAPYQPLAMKCIYCPIDTRLNFIQVSKLLKEVQPLHVVCPEQYTQPPPAQSHRMDLMIDCQPPAMSYRRAEVLALPFKRRYEKIEIMPELADSLVPMEIKPGISLATVSAVLHTKDNKHLLQPPPRPAQPTSGKKRKRVSDDVPDCKVLKPLLSGSIPVEQFVQTLEKHGFSDIKVEDTAKGHIVLLQEAETLIQIEEDSTHIICDNDEMLRVRLRDLVLKFLQKF
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9NV88 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K2 | Ubiquitination | Uniprot | |
K58 | Ubiquitination | Uniprot | |
K66 | Ubiquitination | Uniprot | |
K149 | Ubiquitination | Uniprot | |
K157 | Ubiquitination | Uniprot | |
S167 | Phosphorylation | Uniprot | |
K170 | Ubiquitination | Uniprot | |
K354 | Ubiquitination | Uniprot | |
K372 | Ubiquitination | Uniprot | |
K374 | Ubiquitination | Uniprot | |
K459 | Ubiquitination | Uniprot | |
K462 | Ubiquitination | Uniprot | |
K510 | Ubiquitination | Uniprot | |
T539 | Phosphorylation | Uniprot | |
S564 | Phosphorylation | Uniprot | |
K566 | Acetylation | Uniprot | |
K569 | Ubiquitination | Uniprot | |
S572 | Phosphorylation | Uniprot | |
K579 | Ubiquitination | Uniprot | |
K582 | Ubiquitination | Uniprot | |
K607 | Ubiquitination | Uniprot | |
K653 | Ubiquitination | Uniprot |
Research Backgrounds
Component of the Integrator (INT) complex, a complex involved in the small nuclear RNAs (snRNA) U1 and U2 transcription and in their 3'-box-dependent processing. The Integrator complex is associated with the C-terminal domain (CTD) of RNA polymerase II largest subunit (POLR2A) and is recruited to the U1 and U2 snRNAs genes (Probable). Mediates recruitment of cytoplasmic dynein to the nuclear envelope, probably as component of the INT complex.
Nucleus.
Belongs to the multiprotein complex Integrator, at least composed of INTS1, INTS2, INTS3, INTS4, INTS5, INTS6, INTS7, INTS8, INTS9/RC74, INTS10, INTS11/CPSF3L and INTS12. Interacts with ESRRB, ESRRB is probably not a core component of the multiprotein complex Integrator and this association is a bridge for the interaction with the multiprotein complex Integrator; attracts the transcriptional machinery (By similarity).
Belongs to the metallo-beta-lactamase superfamily. RNA-metabolizing metallo-beta-lactamase-like family. INTS9 subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.