HOXA10 Antibody - #DF13067
| Product: | HOXA10 Antibody |
| Catalog: | DF13067 |
| Description: | Rabbit polyclonal antibody to HOXA10 |
| Application: | WB |
| Reactivity: | Human |
| Prediction: | Horse, Sheep, Dog |
| Mol.Wt.: | 50 kDa; 42kD(Calculated). |
| Uniprot: | P31260 |
| RRID: | AB_2846028 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13067, RRID:AB_2846028.
Fold/Unfold
Centaurin alpha 1 like; Homeo box A10; Homeobox A10; Homeobox protein 1H; Homeobox protein Hox A10; Homeobox protein Hox-1.8; Homeobox protein Hox-1H; Homeobox protein Hox-A10; Homeobox protein HOXA10; HOX 1; HOX 1.8; HOX 1H; HOX A10; HOX1; HOX1.8; HOX1H; HOXA 10; HOXA10; HOXA10 protein; HXA10_HUMAN; MGC12859; PL;
Immunogens
- P31260 HXA10_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSARKGYLLPSPNYPTTMSCSESPAANSFLVDSLISSGRGEAGGGGGGAGGGGGGGYYAHGGVYLPPAADLPYGLQSCGLFPTLGGKRNEAASPGSGGGGGGLGPGAHGYGPSPIDLWLDAPRSCRMEPPDGPPPPPQQQPPPPPQPPQPAPQATSCSFAQNIKEESSYCLYDSADKCPKVSATAAELAPFPRGPPPDGCALGTSSGVPVPGYFRLSQAYGTAKGYGSGGGGAQQLGAGPFPAQPPGRGFDLPPALASGSADAARKERALDSPPPPTLACGSGGGSQGDEEAHASSSAAEELSPAPSESSKASPEKDSLGNSKGENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTANFNFS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P31260 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S19 | Phosphorylation | Uniprot | |
| S93 | Phosphorylation | Uniprot | |
| R193 | Methylation | Uniprot | |
| S272 | Phosphorylation | Uniprot | |
| T277 | Phosphorylation | Uniprot | |
| S313 | Phosphorylation | Uniprot | |
| K323 | Ubiquitination | Uniprot | |
| S335 | Phosphorylation | Uniprot | |
| K338 | Acetylation | Uniprot | |
| K339 | Acetylation | Uniprot | |
| K339 | Ubiquitination | Uniprot | |
| Y343 | Phosphorylation | Uniprot | |
| K345 | Ubiquitination | Uniprot | |
| T348 | Phosphorylation | Uniprot | |
| Y360 | Phosphorylation | Uniprot | |
| R378 | Methylation | Uniprot |
Research Backgrounds
Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Binds to the DNA sequence 5'-AA[AT]TTTTATTAC-3'.
Nucleus.
Interacts with SIRT2; the interaction is direct.
Belongs to the Abd-B homeobox family.
Research Fields
· Human Diseases > Cancers: Overview > Transcriptional misregulation in cancer.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.