Phospho-Smad1 (Ser187) Antibody - #AF3452
Product: | Phospho-Smad1 (Ser187) Antibody |
Catalog: | AF3452 |
Description: | Rabbit polyclonal antibody to Phospho-Smad1 (Ser187) |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse |
Prediction: | Bovine, Sheep, Rabbit, Chicken, Xenopus |
Mol.Wt.: | 60/55kDa; 52kD(Calculated). |
Uniprot: | Q15797 |
RRID: | AB_2834890 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF3452, RRID:AB_2834890.
Fold/Unfold
BSP-1; BSP1; HsMAD1; JV4-1; JV41; MAD homolog 1; MAD mothers against decapentaplegic homolog 1; Mad related protein 1; Mad-related protein 1; MADH1; MADR1; Mothers against decapentaplegic homolog 1; Mothers against DPP homolog 1; SMA- AND MAD-RELATED PROTEIN 1; SMAD 1; SMAD family member 1; SMAD mothers against DPP homolog 1; Smad1; SMAD1_HUMAN; TGF beta signaling protein 1; Transforming growth factor-beta-signaling protein 1;
Immunogens
- Q15797 SMAD1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPNSHPFPHSPNSSYPNSPGSSSSTYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMTQDGSQPMDTNMMAPPLPSEINRGDVQAVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFTDPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNCNYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q15797 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Ubiquitination | Uniprot | ||
S11 | Phosphorylation | Uniprot | |
K21 | Ubiquitination | Uniprot | |
K32 | Ubiquitination | Uniprot | |
S78 | Phosphorylation | Uniprot | |
K81 | Ubiquitination | Uniprot | |
Y88 | Phosphorylation | Uniprot | |
K116 | Sumoylation | Uniprot | |
K116 | Ubiquitination | Uniprot | |
K118 | Sumoylation | Uniprot | |
K118 | Ubiquitination | Uniprot | |
S132 | Phosphorylation | Uniprot | |
S144 | Phosphorylation | Uniprot | |
Y146 | Phosphorylation | Uniprot | |
S187 | Phosphorylation | P50750 (CDK9) , P49336 (CDK8) , P28482 (MAPK1) | Uniprot |
S195 | Phosphorylation | P49336 (CDK8) , P50750 (CDK9) , P28482 (MAPK1) | Uniprot |
T202 | Phosphorylation | P49841 (GSK3B) | Uniprot |
S206 | Phosphorylation | P50750 (CDK9) , P28482 (MAPK1) , P49336 (CDK8) , P50613 (CDK7) | Uniprot |
S210 | Phosphorylation | Uniprot | |
S214 | Phosphorylation | P28482 (MAPK1) , P50750 (CDK9) , P49336 (CDK8) | Uniprot |
S239 | Phosphorylation | Q13315 (ATM) | Uniprot |
K269 | Ubiquitination | Uniprot | |
S315 | Phosphorylation | Uniprot | |
T322 | Phosphorylation | Q8N4C8 (MINK1) , Q9UKE5 (TNIK) | Uniprot |
K418 | Ubiquitination | Uniprot | |
S456 | Phosphorylation | Uniprot | |
S462 | Phosphorylation | O00238 (BMPR1B) | Uniprot |
S463 | Phosphorylation | Q05655 (PRKCD) , P36894 (BMPR1A) , O00238 (BMPR1B) | Uniprot |
S465 | Phosphorylation | Q05655 (PRKCD) , O00238 (BMPR1B) , P36894 (BMPR1A) | Uniprot |
Research Backgrounds
Transcriptional modulator activated by BMP (bone morphogenetic proteins) type 1 receptor kinase. SMAD1 is a receptor-regulated SMAD (R-SMAD). SMAD1/OAZ1/PSMB4 complex mediates the degradation of the CREBBP/EP300 repressor SNIP1. May act synergistically with SMAD4 and YY1 in bone morphogenetic protein (BMP)-mediated cardiac-specific gene expression.
Phosphorylation of the C-terminal SVS motif by BMP type 1 receptor kinase activates SMAD1 by promoting dissociation from the receptor and trimerization with SMAD4.
Ubiquitinated by SMAD-specific E3 ubiquitin ligase SMURF1, leading to its degradation. Monoubiquitinated, leading to prevent DNA-binding. Deubiquitination by USP15 alleviates inhibition and promotes activation of TGF-beta target genes. Dephosphorylation, probably by PPM1A, induces its export from the nucleus to the cytoplasm (By similarity).
Cytoplasm. Nucleus.
Note: Cytoplasmic in the absence of ligand. Migrates to the nucleus when complexed with SMAD4 (PubMed:15647271). Co-localizes with LEMD3 at the nucleus inner membrane (PubMed:15647271). Exported from the nucleus to the cytoplasm when dephosphorylated (By similarity).
Ubiquitous. Highest expression seen in the heart and skeletal muscle.
Found in a complex with SMAD4 and YY1. Interacts with HGS, NANOG and ZCCHC12 (By similarity). Upon C-terminus phosphorylation: forms trimers with another SMAD1 and the co-SMAD SMAD4. Interacts with PEBP2-alpha subunit, CREB-binding protein (CBP), p300, SMURF1, SMURF2, USP15 and HOXC8. Associates with ZNF423 or ZNF521 in response to BMP2 leading to activate transcription of BMP target genes. Interacts with SKOR1. Interacts (via MH2 domain) with LEMD3. Binding to LEMD3 results in at least a partial reduction of receptor-mediated phosphorylation. Forms a ternary complex with PSMB4 and OAZ1 before PSMB4 is incorporated into the 20S proteasome. Found in a macromolecular complex with FAM83G. Interacts (via MH2 domain) with FAM83G (via MH2 domain); in a SMAD4-independent manner. Interacts with ZC3H3 (By similarity). Interacts with TMEM119 (By similarity). Interacts (via MH1 and MH2 domains) with ZNF8 (By similarity). Interacts with RANBP3L; the interaction increases when SMAD1 is not phosphorylated and mediates SMAD1 nuclear export.
The MH2 domain mediates phosphorylation-dependent trimerization through L3 loop binding of phosphoserines in the adjacent subunit.
Belongs to the dwarfin/SMAD family.
Research Fields
· Cellular Processes > Cellular community - eukaryotes > Signaling pathways regulating pluripotency of stem cells. (View pathway)
· Environmental Information Processing > Signal transduction > TGF-beta signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Hippo signaling pathway. (View pathway)
· Human Diseases > Cancers: Overview > Transcriptional misregulation in cancer.
References
Application: WB Species: mouse Sample:
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.