GNPNAT1 Antibody - #DF13048
| Product: | GNPNAT1 Antibody |
| Catalog: | DF13048 |
| Description: | Rabbit polyclonal antibody to GNPNAT1 |
| Application: | WB |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
| Mol.Wt.: | 23 kDa; 21kD(Calculated). |
| Uniprot: | Q96EK6 |
| RRID: | AB_2846009 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13048, RRID:AB_2846009.
Fold/Unfold
AU017428; AU040593; EMeg32; FLJ10607; Glucosamine 6 phosphate acetyltransferase; Glucosamine 6 phosphate N acetyltransferase; Glucosamine 6-phosphate N-acetyltransferase; Glucosamine phosphate N acetyltransferase 1; GNA1; GNA1_HUMAN; GNPNAT; GNPNAT1; Gpnat1; Gsnpat; Phosphoglucosamine acetylase; Phosphoglucosamine transacetylase; RGD1563144;
Immunogens
- Q96EK6 GNA1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKPDETPMFDPSLLKEVDWSQNTATFSPAISPTHPGEGLVLRPLCTADLNRGFFKVLGQLTETGVVSPEQFMKSFEHMKKSGDYYVTVVEDVTLGQIVATATLIIEHKFIHSCAKRGRVEDVVVSDECRGKQLGKLLLSTLTLLSKKLNCYKITLECLPQNVGFYKKFGYTVSEENYMCRRFLK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q96EK6 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K2 | Ubiquitination | Uniprot | |
| K15 | Ubiquitination | Uniprot | |
| S27 | Phosphorylation | Uniprot | |
| S31 | Phosphorylation | Uniprot | |
| K55 | Ubiquitination | Uniprot | |
| S67 | Phosphorylation | Uniprot | |
| K73 | Ubiquitination | Uniprot | |
| Y84 | Phosphorylation | Uniprot | |
| Y85 | Phosphorylation | Uniprot | |
| C113 | S-Nitrosylation | Uniprot | |
| K115 | Ubiquitination | Uniprot | |
| C128 | S-Nitrosylation | Uniprot | |
| K152 | Acetylation | Uniprot | |
| K152 | Ubiquitination | Uniprot | |
| C157 | S-Nitrosylation | Uniprot | |
| Y165 | Phosphorylation | Uniprot | |
| K166 | Acetylation | Uniprot | |
| K166 | Ubiquitination | Uniprot | |
| K167 | Acetylation | Uniprot | |
| K167 | Ubiquitination | Uniprot | |
| S173 | Phosphorylation | Uniprot | |
| Y177 | Phosphorylation | Uniprot |
Research Backgrounds
Golgi apparatus membrane>Peripheral membrane protein. Endosome membrane>Peripheral membrane protein.
Homodimer.
Belongs to the acetyltransferase family. GNA1 subfamily.
Research Fields
· Metabolism > Carbohydrate metabolism > Amino sugar and nucleotide sugar metabolism.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.