GLRX3 Antibody - #DF13041
| Product: | GLRX3 Antibody |
| Catalog: | DF13041 |
| Description: | Rabbit polyclonal antibody to GLRX3 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 37 kDa; 37kD(Calculated). |
| Uniprot: | O76003 |
| RRID: | AB_2846002 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13041, RRID:AB_2846002.
Fold/Unfold
glrx3; GLRX3_HUMAN; GLRX4; Glutaredoxin 3; Glutaredoxin 4; Glutaredoxin-3; GRX3; GRX4; PICOT; PKC interacting cousin of thioredoxin; PKC theta interacting protein; PKC-interacting cousin of thioredoxin; PKC-theta-interacting protein; PKCq interacting protein; PKCq-interacting protein; Thioredoxin like protein 2; Thioredoxin-like protein 2; TXNL2; TXNL3;
Immunogens
Expressed in heart, spleen, testis and, to a lower extent, in thymus and peripheral blood leukocytes. Weakly expressed in lung, placenta, colon and small intestine.
- O76003 GLRX3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFLPSANEHLKEDLNLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKAYSSWPTYPQLYVSGELIGGLDIIKELEASEELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKAYSNWPTYPQLYVKGELVGGLDIVKELKENGELLPILRGEN
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O76003 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| A2 | Acetylation | Uniprot | |
| S32 | Phosphorylation | Uniprot | |
| K67 | Sumoylation | Uniprot | |
| K67 | Ubiquitination | Uniprot | |
| K79 | Ubiquitination | Uniprot | |
| K92 | Ubiquitination | Uniprot | |
| K96 | Ubiquitination | Uniprot | |
| T109 | Phosphorylation | Uniprot | |
| K110 | Acetylation | Uniprot | |
| K110 | Ubiquitination | Uniprot | |
| S117 | Phosphorylation | Uniprot | |
| S118 | Phosphorylation | Uniprot | |
| S120 | Phosphorylation | Uniprot | |
| S124 | Phosphorylation | Uniprot | |
| K130 | Ubiquitination | Uniprot | |
| K139 | Ubiquitination | Uniprot | |
| C146 | S-Nitrosylation | Uniprot | |
| K151 | Ubiquitination | Uniprot | |
| T153 | Phosphorylation | Uniprot | |
| K163 | Ubiquitination | Uniprot | |
| S183 | Phosphorylation | Uniprot | |
| S196 | Phosphorylation | Uniprot | |
| Y200 | Phosphorylation | Uniprot | |
| K231 | Ubiquitination | Uniprot | |
| K234 | Ubiquitination | Uniprot | |
| K240 | Ubiquitination | Uniprot | |
| T301 | Phosphorylation | Uniprot | |
| K319 | Ubiquitination | Uniprot | |
| K322 | Ubiquitination | Uniprot |
Research Backgrounds
Together with BOLA2, acts as a cytosolic iron-sulfur (Fe-S) cluster assembly factor that facilitates [2Fe-2S] cluster insertion into a subset of cytosolic proteins. Acts as a critical negative regulator of cardiac hypertrophy and a positive inotropic regulator (By similarity). Required for hemoglobin maturation. Does not possess any thyoredoxin activity since it lacks the conserved motif that is essential for catalytic activity.
Cytoplasm>Cytosol. Cytoplasm>Cell cortex. Cytoplasm>Myofibril>Sarcomere>Z line.
Note: Under the plasma membrane (By similarity). After PMA stimulation, GLRX3 and PRKCQ/PKC-theta translocate to a more extended submembrane area (By similarity). In the Z line, found associated with CSRP3 (By similarity).
Expressed in heart, spleen, testis and, to a lower extent, in thymus and peripheral blood leukocytes. Weakly expressed in lung, placenta, colon and small intestine.
Homodimer; the homodimer is independent of 2Fe-2S clusters. Heterotrimer; forms a heterotrimeric complex composed by two BOLA2 molecules and one GLRX3 molecule; linked by [2Fe-2S] clusters. Interacts (via N-terminus) with PRKCQ/PKC-theta. Interacts (via C-terminus) with CSRP3 (By similarity). Interacts with CSRP2 (By similarity).
The thioredoxin domain lacks the two redox-active cysteines. This strongly suggests that it lacks thioredoxin activity.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.