FUT6 Antibody - #DF13025
| Product: | FUT6 Antibody |
| Catalog: | DF13025 |
| Description: | Rabbit polyclonal antibody to FUT6 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse |
| Mol.Wt.: | 45 kDa; 42kD(Calculated). |
| Uniprot: | P51993 |
| RRID: | AB_2845986 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13025, RRID:AB_2845986.
Fold/Unfold
Alpha (1,3) fucosyltransferase; EC=2.4.1.65; FCT3A; FT1A; Fuc TVI; fucosyltransferase 6 (alpha (1,3) fucosyltransferase); Fucosyltransferase 6; Fucosyltransferase VI; FucT VI; Galactoside 3 L fucosyltransferase;
Immunogens
- P51993 FUT6_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDPLGPAKPQWSWRCCLTTLLFQLLMAVCFFSYLRVSQDDPTVYPNGSRFPDSTGTPAHSIPLILLWTWPFNKPIALPRCSEMVPGTADCNITADRKVYPQADAVIVHHREVMYNPSAQLPRSPRRQGQRWIWFSMESPSHCWQLKAMDGYFNLTMSYRSDSDIFTPYGWLEPWSGQPAHPPLNLSAKTELVAWAVSNWGPNSARVRYYQSLQAHLKVDVYGRSHKPLPQGTMMETLSRYKFYLAFENSLHPDYITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLARYLQELDKDHARYLSYFRWRETLRPRSFSWALAFCKACWKLQEESRYQTRGIAAWFT
PTMs - P51993 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S123 | Phosphorylation | Uniprot | |
| Y208 | Phosphorylation | Uniprot | |
| Y209 | Phosphorylation | Uniprot | |
| Y221 | Phosphorylation | Uniprot | |
| Y315 | Phosphorylation | Uniprot | |
| T324 | Phosphorylation | Uniprot |
Research Backgrounds
Enzyme involved in the biosynthesis of the E-Selectin ligand, sialyl-Lewis X. Catalyzes the transfer of fucose from GDP-beta-fucose to alpha-2,3 sialylated substrates.
Golgi apparatus>Golgi stack membrane>Single-pass type II membrane protein.
Note: Membrane-bound form in trans cisternae of Golgi.
Kidney, liver, colon, small intestine, bladder, uterus and salivary gland.
Belongs to the glycosyltransferase 10 family.
Research Fields
· Metabolism > Glycan biosynthesis and metabolism > Glycosphingolipid biosynthesis - lacto and neolacto series.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.