FTCD Antibody - #DF13022
Product: | FTCD Antibody |
Catalog: | DF13022 |
Description: | Rabbit polyclonal antibody to FTCD |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 53 kDa; 59kD(Calculated). |
Uniprot: | O95954 |
RRID: | AB_2845983 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13022, RRID:AB_2845983.
Fold/Unfold
Formimidoyltetrahydrofolate cyclodeaminase; Formimidoyltransferase cyclodeaminase; Formiminotetrahydrofolate cyclodeaminase; Formiminotransferase cyclodeaminase; Formiminotransferase-cyclodeaminase; FTCD; FTCD_HUMAN; Glutamate formiminotransferase; Glutamate formyltransferase; LCHC 1; LCHC1; 58K Golgi protein;
Immunogens
- O95954 FTCD_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSQLVECVPNFSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVEGALNAARVASRLIDMSRHQGEHPRMGALDVCPFIPVRGVSVDECVLCAQAFGQRLAEELDVPVYLYGEAARMDSRRTLPAIRAGEYEALPKKLQQADWAPDFGPSSFVPSWGATATGARKFLIAFNINLLGTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEKNLAQVSTNLLDFEVTALHTVYEETCREAQELSLPVVGSQLVGLVPLKALLDAAAFYCEKENLFILEEEQRIRLVVSRLGLDSLCPFSPKERIIEYLVPERGPERGLGSKSLRAFVGEVGARSAAPGGGSVAAAAAAMGAALGSMVGLMTYGRRQFQSLDTTMRRLIPPFREASAKLTTLVDADAEAFTAYLEAMRLPKNTPEEKDRRTAALQEGLRRAVSVPLTLAETVASLWPALQELARCGNLACRSDLQVAAKALEMGVFGAYFNVLINLRDITDEAFKDQIHHRVSSLLQEAKTQAALVLDCLETRQE
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O95954 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Y124 | Phosphorylation | Uniprot | |
Y146 | Phosphorylation | Uniprot | |
Y225 | Phosphorylation | Uniprot | |
Y250 | Phosphorylation | Uniprot | |
S316 | Phosphorylation | Uniprot | |
Y324 | Phosphorylation | Uniprot | |
S358 | Phosphorylation | Uniprot | |
R381 | Methylation | Uniprot | |
S386 | Phosphorylation | Uniprot | |
R399 | Methylation | Uniprot | |
S402 | Phosphorylation | Uniprot | |
R424 | Methylation | Uniprot | |
R436 | Methylation | Uniprot | |
R445 | Methylation | Uniprot | |
S449 | Phosphorylation | Uniprot |
Research Backgrounds
Folate-dependent enzyme, that displays both transferase and deaminase activity. Serves to channel one-carbon units from formiminoglutamate to the folate pool.
Binds and promotes bundling of vimentin filaments originating from the Golgi.
Cytoplasm>Cytoskeleton>Microtubule organizing center>Centrosome>Centriole. Golgi apparatus.
Note: More abundantly located around the mother centriole.
Homooctamer, including four polyglutamate binding sites. The subunits are arranged as a tetramer of dimers, and form a planar ring-shaped structure (By similarity).
In the C-terminal section; belongs to the cyclodeaminase/cyclohydrolase family.
In the N-terminal section; belongs to the formiminotransferase family.
Research Fields
· Metabolism > Amino acid metabolism > Histidine metabolism.
· Metabolism > Metabolism of cofactors and vitamins > One carbon pool by folate.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.