FHL2 Antibody - #DF13015
Product: | FHL2 Antibody |
Catalog: | DF13015 |
Description: | Rabbit polyclonal antibody to FHL2 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 32 kDa; 32kD(Calculated). |
Uniprot: | Q14192 |
RRID: | AB_2845976 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13015, RRID:AB_2845976.
Fold/Unfold
AAG 11; AAG11; Aging associated gene 11; Down regulated in rhabdomyosarcoma LIM protein; Downregulated in rhabdomyosarcoma LIM protein; DRAL; FHL 2; FHL-2; Fhl2; FHL2 protein; FHL2_HUMAN; Four and a half LIM domain protein 2; Four and a half LIM domains 2; Four and a half LIM domains protein 2; KIAA0990; LIM domain protein DRAL; Skeletal muscle LIM protein 3; Skeletal muscle LIM-protein 3; SLIM 3; SLIM-3; SLIM3;
Immunogens
- Q14192 FHL2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTERFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDI
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q14192 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S13 | Phosphorylation | Uniprot | |
K17 | Ubiquitination | Uniprot | |
Y27 | Phosphorylation | Uniprot | |
Y56 | Phosphorylation | Uniprot | |
K57 | Acetylation | Uniprot | |
S74 | Phosphorylation | Uniprot | |
K78 | Sumoylation | Uniprot | |
K78 | Ubiquitination | Uniprot | |
Y93 | Phosphorylation | Uniprot | |
Y97 | Phosphorylation | Uniprot | |
K100 | Ubiquitination | Uniprot | |
K106 | Ubiquitination | Uniprot | |
T107 | Phosphorylation | Uniprot | |
T112 | Phosphorylation | Uniprot | |
K118 | Sumoylation | Uniprot | |
T138 | Phosphorylation | Uniprot | |
K139 | Sumoylation | Uniprot | |
K139 | Ubiquitination | Uniprot | |
S140 | Phosphorylation | Uniprot | |
K144 | Sumoylation | Uniprot | |
K144 | Ubiquitination | Uniprot | |
Y154 | Phosphorylation | Uniprot | |
K156 | Ubiquitination | Uniprot | |
K166 | Ubiquitination | Uniprot | |
K167 | Sumoylation | Uniprot | |
K167 | Ubiquitination | Uniprot | |
T175 | Phosphorylation | Uniprot | |
Y176 | Phosphorylation | Uniprot | |
T189 | Phosphorylation | Uniprot | |
K220 | Sumoylation | Uniprot | |
K220 | Ubiquitination | Uniprot | |
K235 | Ubiquitination | Uniprot | |
Y236 | Phosphorylation | Uniprot | |
S238 | Phosphorylation | Uniprot | |
K252 | Ubiquitination | Uniprot | |
K253 | Sumoylation | Uniprot | |
K253 | Ubiquitination | Uniprot | |
S255 | Phosphorylation | Uniprot | |
K277 | Acetylation | Uniprot | |
K277 | Ubiquitination | Uniprot |
Research Backgrounds
May function as a molecular transmitter linking various signaling pathways to transcriptional regulation. Negatively regulates the transcriptional repressor E4F1 and may function in cell growth. Inhibits the transcriptional activity of FOXO1 and its apoptotic function by enhancing the interaction of FOXO1 with SIRT1 and FOXO1 deacetylation. Negatively regulates the calcineurin/NFAT signaling pathway in cardiomyocytes.
Cytoplasm. Nucleus. Cytoplasm>Myofibril>Sarcomere>Z line.
Expressed in skeletal muscle and heart.
Interacts with ZNF638 and TTN/titin. Interacts with E4F1. Interacts with GRB7. Interacts with SIRT1 and FOXO1. Interacts with CEFIP. Interacts with calcineurin (By similarity). Interacts with FOXK1 (By similarity).
The third LIM zinc-binding mediates interaction with E4F1.
Research Fields
· Organismal Systems > Development > Osteoclast differentiation. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.