FAM134B Antibody - #DF12997
![](/images/pubmed.gif)
Product: | FAM134B Antibody |
Catalog: | DF12997 |
Description: | Rabbit polyclonal antibody to FAM134B |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Xenopus |
Mol.Wt.: | 65 kDa; 55kD(Calculated). |
Uniprot: | Q9H6L5 |
RRID: | AB_2845958 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12997, RRID:AB_2845958.
Fold/Unfold
F134B_HUMAN; FAM134B; family with sequence similarity 134 member B; HSAN2B; JK 1; JK1; Protein FAM134B;
Immunogens
- Q9H6L5 RETR1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MASPAPPEHAEEGCPAPAAEEQAPPSPPPPQASPAERQQQEEEAQEAGAAEGAGLQVEEAAGRAAAAVTWLLGEPVLWLGCRADELLSWKRPLRSLLGFVAANLLFWFLALTPWRVYHLISVMILGRVIMQIIKDMVLSRTRGAQLWRSLSESWEVINSKPDERPRLSHCIAESWMNFSIFLQEMSLFKQQSPGKFCLLVCSVCTFFTILGSYIPGVILSYLLLLCAFLCPLFKCNDIGQKIYSKIKSVLLKLDFGIGEYINQKKRERSEADKEKSHKDDSELDFSALCPKISLTVAAKELSVSDTDVSEVSWTDNGTFNLSEGYTPQTDTSDDLDRPSEEVFSRDLSDFPSLENGMGTNDEDELSLGLPTELKRKKEQLDSGHRPSKETQSAAGLTLPLNSDQTFHLMSNLAGDVITAAVTAAIKDQLEGVQQALSQAAPIPEEDTDTEEGDDFELLDQSELDQIESELGLTQDQEAEAQQNKKSSGFLSNLLGGH
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9H6L5 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S26 | Phosphorylation | Uniprot | |
S151 | Phosphorylation | Uniprot | |
K160 | Ubiquitination | Uniprot | |
K247 | Ubiquitination | Uniprot | |
S276 | Phosphorylation | Uniprot | |
S281 | Phosphorylation | Uniprot | |
S286 | Phosphorylation | Uniprot | |
S293 | Phosphorylation | Uniprot | |
S322 | Phosphorylation | Uniprot | |
Y325 | Phosphorylation | Uniprot | |
T326 | Phosphorylation | Uniprot | |
S344 | Phosphorylation | Uniprot | |
S348 | Phosphorylation | Uniprot | |
S352 | Phosphorylation | Uniprot | |
T359 | Phosphorylation | Uniprot | |
S366 | Phosphorylation | Uniprot | |
S437 | Phosphorylation | Uniprot | |
S486 | Phosphorylation | Uniprot | |
S487 | Phosphorylation | Uniprot | |
S491 | Phosphorylation | Uniprot |
Research Backgrounds
Endoplasmic reticulum-anchored autophagy receptor that mediates ER delivery into lysosomes through sequestration into autophagosomes. Promotes membrane remodeling and ER scission via its membrane bending capacity and targets the fragments into autophagosomes via interaction with ATG8 family proteins. Required for long-term survival of nociceptive and autonomic ganglion neurons.
Golgi apparatus>cis-Golgi network membrane>Multi-pass membrane protein. Endoplasmic reticulum membrane>Multi-pass membrane protein.
Overexpressed in esophageal squamous cell carcinoma.
Interacts with ATG8 family modifier proteins MAP1LC3A, MAP1LC3B, GABARAP, GABARAPL1 and GABARAPL2.
The LIR motif interacts with ATG8 family proteins and is necessary to target the ER fragments to autophagosomes for subsequent lysosomal degradation.
The reticulon homology domain provides capacity to bend the membrane and promotes ER scission (PubMed:26040720). This domain does not show relevant similarities with reticulon domains, preventing any domain predictions within the protein sequence.
Belongs to the RETREG family.
References
Application: WB Species: Human Sample: HEK293T cells
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.