FA2H Antibody - #DF12995
| Product: | FA2H Antibody |
| Catalog: | DF12995 |
| Description: | Rabbit polyclonal antibody to FA2H |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Dog |
| Mol.Wt.: | 43 kDa; 43kD(Calculated). |
| Uniprot: | Q7L5A8 |
| RRID: | AB_2845956 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12995, RRID:AB_2845956.
Fold/Unfold
FA2H; FA2H_HUMAN; FAAH; FAH1; Fatty acid 2 hydroxylase; Fatty acid 2-hydroxylase; Fatty acid alpha hydroxylase; Fatty acid alpha-hydroxylase; Fatty acid hydroxylase domain containing 1; FAXDC1; FLJ25287; SCS7; Spastic paraplegia 35 (autosomal recessive); SPG35;
Immunogens
Detected in differentiating cultured keratinocytes (at protein level). Detected in epidermis and cultured keratinocytes (PubMed:17355976). Highly expressed in brain and colon. Detected at lower levels in testis, prostate, pancreas and kidney (PubMed:15337768).
- Q7L5A8 FA2H_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAPAPPPAASFSPSEVQRRLAAGACWVRRGARLYDLSSFVRHHPGGEQLLRARAGQDISADLDGPPHRHSANARRWLEQYYVGELRGEQQGSMENEPVALEETQKTDPAMEPRFKVVDWDKDLVDWRKPLLWQVGHLGEKYDEWVHQPVTRPIRLFHSDLIEGLSKTVWYSVPIIWVPLVLYLSWSYYRTFAQGNVRLFTSFTTEYTVAVPKSMFPGLFMLGTFLWSLIEYLIHRFLFHMKPPSDSYYLIMLHFVMHGQHHKAPFDGSRLVFPPVPASLVIGVFYLCMQLILPEAVGGTVFAGGLLGYVLYDMTHYYLHFGSPHKGSYLYSLKAHHVKHHFAHQKSGFGISTKLWDYCFHTLTPEKPHLKTQ
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q7L5A8 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K115 | Ubiquitination | Uniprot | |
| K121 | Ubiquitination | Uniprot | |
| K338 | Ubiquitination | Uniprot | |
| S346 | Phosphorylation | Uniprot | |
| T363 | Phosphorylation | Uniprot |
Research Backgrounds
Catalyzes the hydroxylation of free fatty acids at the C-2 position to produce 2-hydroxy fatty acids, which are building blocks of sphingolipids and glycosphingolipids common in neural tissue and epidermis. FA2H is stereospecific for the production of (R)-2-hydroxy fatty acids. Plays an essential role in the synthesis of galactosphingolipids of the myelin sheath (By similarity). Responsible for the synthesis of sphingolipids and glycosphingolipids involved in the formation of epidermal lamellar bodies critical for skin permeability barrier. Participates in the synthesis of glycosphingolipids and a fraction of type II wax diesters in sebaceous gland, specifically regulating hair follicle homeostasis (By similarity). Involved in the synthesis of sphingolipids of plasma membrane rafts, controlling lipid raft mobility and trafficking of raft-associated proteins (By similarity).
Endoplasmic reticulum membrane>Multi-pass membrane protein. Microsome membrane>Multi-pass membrane protein.
Detected in differentiating cultured keratinocytes (at protein level). Detected in epidermis and cultured keratinocytes. Highly expressed in brain and colon. Detected at lower levels in testis, prostate, pancreas and kidney.
The histidine box domains may contain the active site and/or be involved in metal ion binding.
The N-terminal cytochrome b5 heme-binding domain is essential for catalytic activity.
Belongs to the sterol desaturase family. SCS7 subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.