ENY2 Antibody - #DF12979
Product: | ENY2 Antibody |
Catalog: | DF12979 |
Description: | Rabbit polyclonal antibody to ENY2 |
Application: | WB |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 10 kDa; 12kD(Calculated). |
Uniprot: | Q9NPA8 |
RRID: | AB_2845940 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12979, RRID:AB_2845940.
Fold/Unfold
1810057B09Rik; 6720481I12; DC6; e(y)2; Enhancer of yellow 2 transcription factor homolog; eny2; ENY2_HUMAN; Ey2;
Immunogens
- Q9NPA8 ENY2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVVSKMNKDAQMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLEHVTVDDLVAEITPKGRALVPDSVKKELLQRIRTFLAQHASL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9NPA8 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S4 | Phosphorylation | Uniprot | |
K8 | Ubiquitination | Uniprot | |
K19 | Acetylation | Uniprot | |
K19 | Ubiquitination | Uniprot | |
K30 | Ubiquitination | Uniprot | |
K36 | Ubiquitination | Uniprot | |
C40 | S-Nitrosylation | Uniprot | |
K43 | Acetylation | Uniprot | |
K43 | Ubiquitination | Uniprot | |
K57 | Ubiquitination | Uniprot | |
T72 | Phosphorylation | Uniprot | |
K74 | Ubiquitination | Uniprot | |
S82 | Phosphorylation | Uniprot | |
S100 | Phosphorylation | Uniprot |
Research Backgrounds
Involved in mRNA export coupled transcription activation by association with both the TREX-2 and the SAGA complexes. The transcription regulatory histone acetylation (HAT) complex SAGA is a multiprotein complex that activates transcription by remodeling chromatin and mediating histone acetylation and deubiquitination. Within the SAGA complex, participates in a subcomplex that specifically deubiquitinates both histones H2A and H2B. The SAGA complex is recruited to specific gene promoters by activators such as MYC, where it is required for transcription. Required for nuclear receptor-mediated transactivation. As a component of the TREX-2 complex, involved in the export of mRNAs to the cytoplasm through the nuclear pores.
Nucleus>Nucleoplasm. Nucleus>Nuclear pore complex.
Note: Localization at the nuclear pore complex requires NUP153 and TPR.
Component of the nuclear pore complex (NPC)-associated TREX-2 complex (transcription and export complex 2), composed of at least ENY2, the isoform GANP of the MCM3AP gene, PCID2, SEM1, and either centrin CETN2 or CETN3. TREX-2 contains 2 ENY2 chains. The TREX-2 complex also associates with ALYREF/ALY and with the nucleoporin NUP153. Component of some SAGA transcription coactivator-HAT complexes, at least composed of ATXN7, ATXN7L3, ENY2, GCN5L2, SUPT3H/SPT3, TAF10, TRRAP and USP22. Within the SAGA complex, ENY2, ATXN7, ATXN7L3, and USP22 form an additional subcomplex of SAGA called the DUB module (deubiquitination module). Interacts with RNA polymerase II subunit POLR2A. Interacts with ATXN7L3B.
Belongs to the ENY2 family.
References
Application: WB Species: Mouse Sample: BSR-T7/5 cells
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.