EIF2G/EIF2S3 Antibody - #DF12974
| Product: | EIF2G/EIF2S3 Antibody |
| Catalog: | DF12974 |
| Description: | Rabbit polyclonal antibody to EIF2G/EIF2S3 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse |
| Prediction: | Zebrafish, Bovine, Horse, Sheep, Dog, Chicken, Xenopus |
| Mol.Wt.: | 52 kDa; 51kD(Calculated). |
| Uniprot: | P41091 |
| RRID: | AB_2845935 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12974, RRID:AB_2845935.
Fold/Unfold
eIF-2-gamma X; eIF-2gA; eIF-2gX; EIF2; EIF2G; EIF2gamma; EIF2S3; Eukaryotic translation initiation factor 2 gamma; Eukaryotic translation initiation factor 2 gamma subunit; Eukaryotic translation initiation factor 2 subunit 3; Eukaryotic translation initiation factor 2 subunit 3 gamma 52kDa; Eukaryotic translation initiation factor 2 subunit gamma X; IF2G_HUMAN;
Immunogens
- P41091 IF2G_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAGGEAGVTLGQPHLSRQDLTTLDVTKLTPLSHEVISRQATINIGTIGHVAHGKSTVVKAISGVHTVRFKNELERNITIKLGYANAKIYKLDDPSCPRPECYRSCGSSTPDEFPTDIPGTKGNFKLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIMKLKHILILQNKIDLVKESQAKEQYEQILAFVQGTVAEGAPIIPISAQLKYNIEVVCEYIVKKIPVPPRDFTSEPRLIVIRSFDVNKPGCEVDDLKGGVAGGSILKGVLKVGQEIEVRPGIVSKDSEGKLMCKPIFSKIVSLFAEHNDLQYAAPGGLIGVGTKIDPTLCRADRMVGQVLGAVGALPEIFTELEISYFLLRRLLGVRTEGDKKAAKVQKLSKNEVLMVNIGSLSTGGRVSAVKADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTVDDD
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P41091 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| T9 | Phosphorylation | Uniprot | |
| S16 | Phosphorylation | Uniprot | |
| T21 | Phosphorylation | Uniprot | |
| K27 | Ubiquitination | Uniprot | |
| K54 | Ubiquitination | Uniprot | |
| S55 | Phosphorylation | Uniprot | |
| T56 | Phosphorylation | Uniprot | |
| K59 | Methylation | Uniprot | |
| K59 | Ubiquitination | Uniprot | |
| T66 | Phosphorylation | P17252 (PRKCA) | Uniprot |
| K70 | Ubiquitination | Uniprot | |
| K80 | Ubiquitination | Uniprot | |
| K87 | Ubiquitination | Uniprot | |
| K90 | Acetylation | Uniprot | |
| K90 | Ubiquitination | Uniprot | |
| S104 | Phosphorylation | Uniprot | |
| C105 | S-Nitrosylation | Uniprot | |
| T109 | Phosphorylation | Uniprot | |
| K121 | Ubiquitination | Uniprot | |
| K125 | Ubiquitination | Uniprot | |
| K183 | Ubiquitination | Uniprot | |
| K191 | Ubiquitination | Uniprot | |
| K196 | Ubiquitination | Uniprot | |
| K201 | Ubiquitination | Uniprot | |
| C236 | S-Nitrosylation | Uniprot | |
| Y238 | Phosphorylation | Uniprot | |
| K242 | Ubiquitination | Uniprot | |
| K266 | Ubiquitination | Uniprot | |
| K275 | Ubiquitination | Uniprot | |
| K285 | Ubiquitination | Uniprot | |
| K289 | Ubiquitination | Uniprot | |
| S302 | Phosphorylation | Uniprot | |
| K303 | Acetylation | Uniprot | |
| K303 | Ubiquitination | Uniprot | |
| K308 | Ubiquitination | Uniprot | |
| K312 | Acetylation | Uniprot | |
| K312 | Ubiquitination | Uniprot | |
| Y330 | Phosphorylation | Uniprot | |
| K342 | Ubiquitination | Uniprot | |
| K400 | Ubiquitination | Uniprot | |
| S410 | Phosphorylation | Uniprot | |
| S412 | Phosphorylation | Uniprot | |
| T413 | Phosphorylation | Uniprot | |
| S418 | Phosphorylation | Uniprot | |
| K421 | Ubiquitination | Uniprot | |
| K426 | Ubiquitination | Uniprot | |
| T435 | Phosphorylation | Uniprot | |
| K440 | Ubiquitination | Uniprot | |
| K466 | Ubiquitination | Uniprot |
Research Backgrounds
As a subunit of eukaryotic initiation factor 2 (eIF2), involved in the early steps of protein synthesis. In the presence of GTP, eIF2 forms a ternary complex with initiator tRNA Met-tRNAi and then recruits the 40S ribosomal complex, a step that determines the rate of protein translation. This step is followed by mRNA binding to form the 43S pre-initiation complex. Junction of the 60S ribosomal subunit to form the 80S initiation complex is preceded by hydrolysis of the GTP bound to eIF2 and release of an eIF2-GDP binary complex. In order for eIF2 to recycle and catalyze another round of initiation, the GDP bound to eIF2 must exchange with GTP by way of a reaction catalyzed by eIF2B (By similarity). Along with its paralog on chromosome Y, may contribute to spermatogenesis up to the round spermatid stage (By similarity).
Expressed in testis, brain, liver and muscle.
The eukaryotic translation initiation factor 2 complex/eIF2 is a heterotrimer composed of an alpha subunit, also called subunit 1 (encoded by EIF2S1), a beta subunit, also called subunit 2 (encoded by EIF2S2) and a gamma subunit, also called subunit 3 (encoded by EIF2S3).
Belongs to the TRAFAC class translation factor GTPase superfamily. Classic translation factor GTPase family. EIF2G subfamily.
Research Fields
· Genetic Information Processing > Translation > RNA transport.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.