EAF1 Antibody - #DF12967
Product: | EAF1 Antibody |
Catalog: | DF12967 |
Description: | Rabbit polyclonal antibody to EAF1 |
Application: | WB |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 43 kDa; 29kD(Calculated). |
Uniprot: | Q96JC9 |
RRID: | AB_2845928 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12967, RRID:AB_2845928.
Fold/Unfold
ELL (eleven nineteen lysine rich leukemia gene) associated factor 1;
Immunogens
Strongly expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, spleen, prostate, testis, small intestine and colon. Poorly expressed in thymus.
- Q96JC9 EAF1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MNGTANPLLDREEHCLRLGESFEKRPRASFHTIRYDFKPASIDTSCEGELQVGKGDEVTITLPHIPGSTPPMTVFKGNKRPYQKDCVLIINHDTGEYVLEKLSSSIQVKKTRAEGSSKIQARMEQQPTRPPQTSQPPPPPPPMPFRAPTKPPVGPKTSPLKDNPSPEPQLDDIKRELRAEVDIIEQMSSSSGSSSSDSESSSGSDDDSSSSGGEDNGPASPPQPSHQQPYNSRPAVANGTSRPQGSNQLMNTLRNDLQLSESGSDSDD
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q96JC9 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S21 | Phosphorylation | Uniprot | |
K24 | Ubiquitination | Uniprot | |
S29 | Phosphorylation | Uniprot | |
K150 | Acetylation | Uniprot | |
T157 | Phosphorylation | Uniprot | |
S158 | Phosphorylation | Uniprot | |
S165 | Phosphorylation | Uniprot | |
S260 | Phosphorylation | Uniprot | |
S262 | Phosphorylation | Uniprot | |
S264 | Phosphorylation | Uniprot | |
S266 | Phosphorylation | Uniprot |
Research Backgrounds
Acts as a transcriptional transactivator of ELL and ELL2 elongation activities.
Nucleus speckle. Nucleus>Cajal body.
Strongly expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, spleen, prostate, testis, small intestine and colon. Poorly expressed in thymus.
Component of the super elongation complex (SEC), at least composed of EAF1, EAF2, CDK9, MLLT3/AF9, AFF (AFF1 or AFF4), the P-TEFb complex and ELL (ELL, ELL2 or ELL3). Interacts with ELL and ELL2.
Belongs to the EAF family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.