DIO2 Antibody - #DF12941
| Product: | DIO2 Antibody |
| Catalog: | DF12941 |
| Description: | Rabbit polyclonal antibody to DIO2 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Rabbit, Dog, Chicken |
| Mol.Wt.: | 31 kDa; 31kD(Calculated). |
| Uniprot: | Q92813 |
| RRID: | AB_2845902 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12941, RRID:AB_2845902.
Fold/Unfold
5DII; D2; Deiodinase, iodothyronine, type II; DIO2; DIOII; EC 1.97.1.10; IOD2_HUMAN; ITDI2; SelY; Thyroxine deiodinase, type II; TXDI2; Type 2 DI; Type 2 iodothyronine deiodinase; Type II 5' deiodinase; Type II iodothyronine deiodinase; Type-II 5''-deiodinase;
Immunogens
A synthesized peptide derived from human DIO2, corresponding to a region within N-terminal amino acids.
Isoform 1 is expressed in the lung, trachea, kidney, heart, skeletal muscle, placenta, fetal brain and several regions of the adult brain (PubMed:8755651, PubMed:11165050). Isoform 2 is expressed in the brain, heart, kidney and trachea (PubMed:11165050).
- Q92813 IOD2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGILSVDLLITLQILPVFFSNCLFLALYDSVILLKHVVLLLSRSKSTRGEWRRMLTSEGLRCVWKSFLLDAYKQVKLGEDAPNSSVVHVSSTEGGDNSGNGTQEKIAEGATCHLLDFASPERPLVVNFGSATUPPFTSQLPAFRKLVEEFSSVADFLLVYIDEAHPSDGWAIPGDSSLSFEVKKHQNQEDRCAAAQQLLERFSLPPQCRVVADRMDNNANIAYGVAFERVCIVQRQKIAYLGGKGPFSYNLQEVRHWLEKNFSKRUKKTRLAG
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Responsible for the deiodination of T4 (3,5,3',5'-tetraiodothyronine) into T3 (3,5,3'-triiodothyronine). Essential for providing the brain with appropriate levels of T3 during the critical period of development.
Ubiquitinated by MARCHF6, leading to its degradation by the proteasome. Deubiquitinated by USP20 and USP33.
Membrane>Single-pass membrane protein.
Isoform 1 is expressed in the lung, trachea, kidney, heart, skeletal muscle, placenta, fetal brain and several regions of the adult brain. Isoform 2 is expressed in the brain, heart, kidney and trachea.
Belongs to the iodothyronine deiodinase family.
Research Fields
· Organismal Systems > Endocrine system > Thyroid hormone signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.