Cytoglobin Antibody - #DF12928
| Product: | Cytoglobin Antibody |
| Catalog: | DF12928 |
| Description: | Rabbit polyclonal antibody to Cytoglobin |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
| Mol.Wt.: | 27 kDa; 21kD(Calculated). |
| Uniprot: | Q8WWM9 |
| RRID: | AB_2845889 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12928, RRID:AB_2845889.
Fold/Unfold
Cygb; CYGB_HUMAN; Cytoglobin; Hgb; Histoglobin; STAP; Stellate cell activation associated protein; Stellate cell activation-associated protein;
Immunogens
Ubiquitously expressed. Highest expression in heart, stomach, bladder and small intestine.
- Q8WWM9 CYGB_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGP
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q8WWM9 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| T180 | Phosphorylation | Uniprot | |
| T184 | Phosphorylation | Uniprot |
Research Backgrounds
May have a protective function during conditions of oxidative stress. May be involved in intracellular oxygen storage or transfer.
Cytoplasm.
Ubiquitously expressed. Highest expression in heart, stomach, bladder and small intestine.
Homodimer; disulfide-linked.
Belongs to the globin family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.