COQ5 Antibody - #DF12910
| Product: | COQ5 Antibody |
| Catalog: | DF12910 |
| Description: | Rabbit polyclonal antibody to COQ5 |
| Application: | WB |
| Reactivity: | Human, Mouse |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
| Mol.Wt.: | 37 kDa, 30 kDa; 37kD(Calculated). |
| Uniprot: | Q5HYK3 |
| RRID: | AB_2845871 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12910, RRID:AB_2845871.
Fold/Unfold
2-methoxy-6-polyprenyl-1; 4-benzoquinol methylase; COQ5; COQ5_HUMAN; mitochondrial; Ubiquinone biosynthesis methyltransferase COQ5; Ubiquinone biosynthesis methyltransferase COQ5, mitochondrial;
Immunogens
Widely expressed, with highest levels in liver, lung, placenta and skeletal muscle.
- Q5HYK3 COQ5_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAAPGSCALWSYCGRGWSRAMRGCQLLGLRSSWPGDLLSARLLSQEKRAAETHFGFETVSEEEKGGKVYQVFESVAKKYDVMNDMMSLGIHRVWKDLLLWKMHPLPGTQLLDVAGGTGDIAFRFLNYVQSQHQRKQKRQLRAQQNLSWEEIAKEYQNEEDSLGGSRVVVCDINKEMLKVGKQKALAQGYRAGLAWVLGDAEELPFDDDKFDIYTIAFGIRNVTHIDQALQEAHRVLKPGGRFLCLEFSQVNNPLISRLYDLYSFQVIPVLGEVIAGDWKSYQYLVESIRRFPSQEEFKDMIEDAGFHKVTYESLTSGIVAIHSGFKL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q5HYK3 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| T58 | Phosphorylation | Uniprot | |
| S60 | Phosphorylation | Uniprot | |
| Y69 | Phosphorylation | Uniprot | |
| K95 | Ubiquitination | Uniprot | |
| Y283 | Phosphorylation | Uniprot |
Research Backgrounds
Methyltransferase required for the conversion of 2-polyprenyl-6-methoxy-1,4-benzoquinol (DDMQH2) to 2-polyprenyl-3-methyl-6-methoxy-1,4-benzoquinol (DMQH2).
Mitochondrion inner membrane>Peripheral membrane protein>Matrix side.
Widely expressed, with highest levels in liver, lung, placenta and skeletal muscle.
Component of a multi-subunit COQ enzyme complex, composed of at least COQ3, COQ4, COQ5, COQ6, COQ7 and COQ9.
Belongs to the class I-like SAM-binding methyltransferase superfamily. MenG/UbiE family.
Research Fields
· Metabolism > Metabolism of cofactors and vitamins > Ubiquinone and other terpenoid-quinone biosynthesis.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.