CHMP1A Antibody - #DF12894
| Product: | CHMP1A Antibody |
| Catalog: | DF12894 |
| Description: | Rabbit polyclonal antibody to CHMP1A |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse |
| Prediction: | Pig, Bovine, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 25 kDa; 22kD(Calculated). |
| Uniprot: | Q9HD42 |
| RRID: | AB_2845855 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12894, RRID:AB_2845855.
Fold/Unfold
Charged multivesicular body protein 1a; CHM1A_HUMAN; CHMP1a; Chromatin modifying protein 1a; Chromatin-modifying protein 1a; hVps46 1; hVps46-1; KIAA0047; Metalloprotease 1; PCOLN3; Procollagen (type III) N endopeptidase; PRSM1; Vacuolar protein sorting 46 1; Vacuolar protein sorting-associated protein 46-1; Vps46 1; Vps46-1;
Immunogens
Expressed in placenta, cultured skin fibroblasts and in osteoblast cell line MG-63.
- Q9HD42 CHM1A_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDDTLFQLKFTAKQLEKLAKKAEKDSKAEQAKVKKALLQKNVECARVYAENAIRKKNEGVNWLRMASRVDAVASKVQTAVTMKGVTKNMAQVTKALDKALSTMDLQKVSSVMDRFEQQVQNLDVHTSVMEDSMSSATTLTTPQEQVDSLIMQIAEENGLEVLDQLSQLPEGASAVGESSVRSQEDQLSRRLAALRN
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9HD42 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| M1 | Acetylation | Uniprot | |
| K13 | Ubiquitination | Uniprot | |
| K27 | Acetylation | Uniprot | |
| K40 | Acetylation | Uniprot | |
| K40 | Ubiquitination | Uniprot | |
| Y48 | Phosphorylation | Uniprot | |
| K56 | Ubiquitination | Uniprot | |
| S67 | Phosphorylation | Uniprot | |
| K75 | Ubiquitination | Uniprot | |
| K83 | Ubiquitination | Uniprot | |
| K87 | Acetylation | Uniprot | |
| K87 | Ubiquitination | Uniprot | |
| K94 | Ubiquitination | Uniprot | |
| K98 | Ubiquitination | Uniprot | |
| S101 | Phosphorylation | Uniprot | |
| S173 | Phosphorylation | Uniprot | |
| S178 | Phosphorylation | Uniprot | |
| S179 | Phosphorylation | Uniprot | |
| S182 | Phosphorylation | Uniprot | |
| S188 | Phosphorylation | Uniprot |
Research Backgrounds
Probable peripherally associated component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. The MVB pathway appears to require the sequential function of ESCRT-O, -I,-II and -III complexes. ESCRT-III proteins mostly dissociate from the invaginating membrane before the ILV is released. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and the budding of enveloped viruses (HIV-1 and other lentiviruses). ESCRT-III proteins are believed to mediate the necessary vesicle extrusion and/or membrane fission activities, possibly in conjunction with the AAA ATPase VPS4. Involved in cytokinesis. Involved in recruiting VPS4A and/or VPS4B to the midbody of dividing cells. May also be involved in chromosome condensation. Targets the Polycomb group (PcG) protein BMI1/PCGF4 to regions of condensed chromatin. May play a role in stable cell cycle progression and in PcG gene silencing.
Cytoplasm. Endosome membrane>Peripheral membrane protein. Nucleus matrix.
Note: The cytoplasmic form is partially membrane-associated and localizes to early endosomes. The nuclear form remains associated with the chromosome scaffold during mitosis. On overexpression, it localizes to nuclear bodies characterized by nuclease-resistant condensed chromatin.
Expressed in placenta, cultured skin fibroblasts and in osteoblast cell line MG-63.
Probable peripherally associated component of the endosomal sorting required for transport complex III (ESCRT-III). ESCRT-III components are thought to multimerize to form a flat lattice on the perimeter membrane of the endosome. Several assembly forms of ESCRT-III may exist that interact and act sequentially. Self-associates. Interacts with CHMP1B. Interacts with VPS4A. Interacts with VPS4B. Interacts with PHF1. Interacts with IST1. Interacts with MITD1.
Belongs to the SNF7 family.
Research Fields
· Cellular Processes > Transport and catabolism > Endocytosis. (View pathway)
· Cellular Processes > Cell growth and death > Necroptosis. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.