KLK3 Antibody - #AF0246
![](/images/pubmed.gif)
Product: | KLK3 Antibody |
Catalog: | AF0246 |
Description: | Rabbit polyclonal antibody to KLK3 |
Application: | WB IHC |
Reactivity: | Human, Mouse |
Mol.Wt.: | 34kDa; 29kD(Calculated). |
Uniprot: | P07288 |
RRID: | AB_2833421 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF0246, RRID:AB_2833421.
Fold/Unfold
antigen, prostate-specific; APS; Gamma seminoprotein; Gamma-seminoprotein; hK3; Kallikrein 3; Kallikrein related peptidase 3; Kallikrein-3; KLK 3; KLK2A1; Klk3; KLK3_HUMAN; P-30 antigen; P30 antigen; Prostate-specific antigen; Psa; Semenogelase; Seminin;
Immunogens
- P07288 KLK3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP
PTMs - P07288 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
T143 | Phosphorylation | Uniprot | |
T167 | Phosphorylation | Uniprot | |
K251 | Ubiquitination | Uniprot | |
K254 | Ubiquitination | Uniprot |
Research Backgrounds
Hydrolyzes semenogelin-1 thus leading to the liquefaction of the seminal coagulum.
Secreted.
Forms a heterodimer with SERPINA5.
Belongs to the peptidase S1 family. Kallikrein subfamily.
Research Fields
· Human Diseases > Cancers: Overview > Pathways in cancer. (View pathway)
· Human Diseases > Cancers: Specific types > Prostate cancer. (View pathway)
References
Application: WB Species: Mouse Sample:
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.