C1orf77 Antibody - #DF12868
Product: | C1orf77 Antibody |
Catalog: | DF12868 |
Description: | Rabbit polyclonal antibody to C1orf77 |
Application: | WB |
Reactivity: | Human, Mouse |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit |
Mol.Wt.: | 26 kDa; 26kD(Calculated). |
Uniprot: | Q9Y3Y2 |
RRID: | AB_2845829 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12868, RRID:AB_2845829.
Fold/Unfold
C1orf77; chromatin target of chromatin target of PRMT1 protein; Chromatin target of PRMT1; Chromatin target of PRMT1 protein; Chromosome 1 open reading frame 77; CHTOP; CHTOP_HUMAN; DKFZp547E1010; FL- RP1-178F15.2; FL-SRAG; FOP; Friend of PRMT1; Friend of PRMT1 protein; HT031; MGC131924; MGC86949; OTTHUMP00000035122; OTTHUMP00000035123; Pp7704; RP1 178F15.2; Small arginine- and glycine-rich protein; Small protein rich in arginine and glycine; SRAG; SRAG-3; SRAG-5;
Immunogens
Expressed in an erythroid progenitor cell line derived from peripheral blood. Expressed in glioblastoma cells (PubMed:25284789).
- Q9Y3Y2 CHTOP_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAAQSAPKVVLKSTTKMSLNERFTNMLKNKQPTPVNIRASMQQQQQLASARNRRLAQQMENRPSVQAALKLKQSLKQRLGKSNIQARLGRPIGALARGAIGGRGLPIIQRGLPRGGLRGGRATRTLLRGGMSLRGQNLLRGGRAVAPRMGLRRGGVRGRGGPGRGGLGRGAMGRGGIGGRGRGMIGRGRGGFGGRGRGRGRGRGALARPVLTKEQLDNQLDAYMSKTKGHLDAELDAYMAQTDPETND
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9Y3Y2 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
A2 | Acetylation | Uniprot | |
K8 | Ubiquitination | Uniprot | |
K12 | Acetylation | Uniprot | |
K12 | Ubiquitination | Uniprot | |
K16 | Ubiquitination | Uniprot | |
K28 | Ubiquitination | Uniprot | |
K30 | Acetylation | Uniprot | |
K30 | Ubiquitination | Uniprot | |
T33 | Phosphorylation | Uniprot | |
S40 | Phosphorylation | Uniprot | |
S49 | Phosphorylation | Uniprot | |
S64 | Phosphorylation | Uniprot | |
K70 | Acetylation | Uniprot | |
K70 | Ubiquitination | Uniprot | |
K81 | Ubiquitination | Uniprot | |
R97 | Methylation | Uniprot | |
R103 | Methylation | Uniprot | |
R110 | Methylation | Uniprot | |
R114 | Methylation | Uniprot | |
R118 | Methylation | Uniprot | |
R121 | Methylation | Uniprot | |
R128 | Methylation | Uniprot | |
R134 | Methylation | Uniprot | |
R140 | Methylation | Uniprot | |
R143 | Methylation | Uniprot | |
R148 | Methylation | Uniprot | |
R152 | Methylation | Uniprot | |
R153 | Methylation | Uniprot | |
R157 | Methylation | Uniprot | |
R159 | Methylation | Uniprot | |
R164 | Methylation | Uniprot | |
R169 | Methylation | Uniprot | |
R174 | Methylation | Uniprot | |
R180 | Methylation | Uniprot | |
R182 | Methylation | Uniprot | |
R187 | Methylation | Uniprot | |
R189 | Methylation | Uniprot | |
R203 | Methylation | Uniprot | |
R208 | Methylation | Uniprot | |
T212 | Phosphorylation | O14757 (CHEK1) | Uniprot |
K213 | Ubiquitination | Uniprot | |
K226 | Ubiquitination | Uniprot | |
T227 | Phosphorylation | Uniprot | |
K228 | Ubiquitination | Uniprot | |
T242 | Phosphorylation | Uniprot |
Research Backgrounds
Plays an important role in the ligand-dependent activation of estrogen receptor target genes. May play a role in the silencing of fetal globin genes. Recruits the 5FMC complex to ZNF148, leading to desumoylation of ZNF148 and subsequent transactivation of ZNF148 target genes (By similarity). Plays an important role in the tumorigenicity of glioblastoma cells. Binds to 5-hydroxymethylcytosine (5hmC) and associates with the methylosome complex containing PRMT1, PRMT5, MEP50 and ERH. The CHTOP-methylosome complex associated with 5hmC is recruited to selective sites on the chromosome, where it methylates H4R3 and activates the transcription of genes involved in glioblastomagenesis.
Required for effective mRNA nuclear export and is a component of the TREX complex which is thought to couple mRNA transcription, processing and nuclear export, and specifically associates with spliced mRNA and not with unspliced pre-mRNA. TREX is recruited to spliced mRNAs by a transcription-independent mechanism, binds to mRNA upstream of the exon-junction complex (EJC) and is recruited in a splicing- and cap-dependent manner to a region near the 5' end of the mRNA where it functions in mRNA export to the cytoplasm via the TAP/NFX1 pathway. The TREX complex is essential for the export of Kaposi's sarcoma-associated herpesvirus (KSHV) intronless mRNAs and infectious virus production. Stimulates DDX39B ATPase and helicase activities. In cooperation with ALYREF/THOC4 enhances NXF1 RNA binding activity.
Asymmetrically methylated by PRMT1. Symmetrically methylated by PRMT5 (By similarity).
Nucleus. Nucleus>Nucleolus. Nucleus>Nucleoplasm. Nucleus speckle.
Note: Mostly associated with facultative heterochromatin (By similarity). Localizes to regions surrounding nuclear speckles known as perispeckles in which TREX complex assembly seems to occur (PubMed:23826332).
Expressed in an erythroid progenitor cell line derived from peripheral blood. Expressed in glioblastoma cells.
Interacts with PRMT1 and PRMT5. Interacts with the 5FMC complex; the interaction is methylation-dependent. Interacts with FYTTD1, SET and PRC1 complex members CBX4, RNF2 and PHC2; the interactions are methylation-independent. Interacts with ZNF148 (By similarity). Component of the transcription/export (TREX) complex at least composed of ALYREF/THOC4, DDX39B, SARNP/CIP29, CHTOP and the THO subcomplex; TREX seems to have dynamic structure involving ATP-dependent remodeling; in the complex interacts (methylated) with ALYREF/THOC4 and with DDX39B in a methylation-independent manner. Interacts (methylated) with NXF1; the interaction is mutually exclusive with the NXF1:THOC5 interaction. Interacts with WDR77 and ERH.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.