AP3M1 Antibody - #DF12826
Product: | AP3M1 Antibody |
Catalog: | DF12826 |
Description: | Rabbit polyclonal antibody to AP3M1 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
Mol.Wt.: | 47 kDa; 47kD(Calculated). |
Uniprot: | Q9Y2T2 |
RRID: | AB_2845787 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12826, RRID:AB_2845787.
Fold/Unfold
Adapter-related protein complex 3 mu-1 subunit; AP-3 adapter complex mu3A subunit; AP-3 complex subunit mu-1; AP3M1; AP3M1_HUMAN; Clathrin adaptor complex AP3 mu 3A subunit; Mu-adaptin 3A; mu3A; Mu3A-adaptin;
Immunogens
- Q9Y2T2 AP3M1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MIHSLFLINCSGDIFLEKHWKSVVSQSVCDYFFEAQEKAADVENVPPVISTPHHYLISIYRDKLFFVSVIQTEVPPLFVIEFLHRVADTFQDYFGECSEAAIKDNVVIVYELLEEMLDNGFPLATESNILKELIKPPTILRSVVNSITGSSNVGDTLPTGQLSNIPWRRAGVKYTNNEAYFDVVEEIDAIIDKSGSTVFAEIQGVIDACIKLSGMPDLSLSFMNPRLLDDVSFHPCIRFKRWESERVLSFIPPDGNFRLISYRVSSQNLVAIPVYVKHSISFKENSSCGRFDITIGPKQNMGKTIEGITVTVHMPKVVLNMNLTPTQGSYTFDPVTKVLTWDVGKITPQKLPSLKGLVNLQSGAPKPEENPSLNIQFKIQQLAISGLKVNRLDMYGEKYKPFKGVKYVTKAGKFQVRT
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9Y2T2 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S25 | Phosphorylation | Uniprot | |
Y31 | Phosphorylation | Uniprot | |
K135 | Ubiquitination | Uniprot | |
S146 | Phosphorylation | Uniprot | |
K173 | Ubiquitination | Uniprot | |
K283 | Methylation | Uniprot | |
K283 | Ubiquitination | Uniprot | |
K298 | Ubiquitination | Uniprot | |
T304 | Phosphorylation | Uniprot | |
T309 | Phosphorylation | Uniprot | |
T311 | Phosphorylation | Uniprot | |
K345 | Ubiquitination | Uniprot | |
T347 | Phosphorylation | Uniprot | |
K350 | Ubiquitination | Uniprot | |
K355 | Ubiquitination | Uniprot | |
K388 | Ubiquitination | Uniprot | |
K398 | Ubiquitination | Uniprot | |
Y399 | Phosphorylation | Uniprot | |
K406 | Ubiquitination | Uniprot | |
K413 | Ubiquitination | Uniprot |
Research Backgrounds
Part of the AP-3 complex, an adaptor-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes. In concert with the BLOC-1 complex, AP-3 is required to target cargos into vesicles assembled at cell bodies for delivery into neurites and nerve terminals.
Golgi apparatus. Cytoplasmic vesicle membrane>Peripheral membrane protein>Cytoplasmic side.
Note: Component of the coat surrounding the cytoplasmic face of coated vesicles located at the Golgi complex.
Adaptor protein complex 3 (AP-3) is a heterotetramer composed of two large adaptins (delta-type subunit AP3D1 and beta-type subunit AP3B1 or AP3B2), a medium adaptin (mu-type subunit AP3M1 or AP3M2) and a small adaptin (sigma-type subunit APS1 or AP3S2). Interacts with AGAP1. AP-3 associates with the BLOC-1 complex (By similarity).
(Microbial infection) Interacts with human respiratory virus (HRSV) protein M.
Belongs to the adaptor complexes medium subunit family.
Research Fields
· Cellular Processes > Transport and catabolism > Lysosome. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.