AADAT Antibody - #DF12804
Product: | AADAT Antibody |
Catalog: | DF12804 |
Description: | Rabbit polyclonal antibody to AADAT |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Bovine, Rabbit, Dog, Chicken |
Mol.Wt.: | 48 kDa; 47kD(Calculated). |
Uniprot: | Q8N5Z0 |
RRID: | AB_2845765 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12804, RRID:AB_2845765.
Fold/Unfold
2 aminoadipate aminotransferase; 2 aminoadipate transaminase; 2-aminoadipate aminotransferase; 2-aminoadipate transaminase; Aadat; AADAT_HUMAN; Aadt; AI875679; Alpha aminoadipate aminotransferase; Alpha-aminoadipate aminotransferase; Aminoadipate aminotransferase; EC 2.6.1.39; EC 2.6.1.7; KAT/AadAT; KAT2; KATII; Kynurenine oxoglutarate transaminase 2; Kynurenine aminotransferase II; Kynurenine oxoglutarate aminotransferase II; Kynurenine oxoglutarate transaminase II; Kynurenine--oxoglutarate aminotransferase II; Kynurenine--oxoglutarate transaminase II; Kynurenine/alpha-aminoadipate aminotransferase mitochondrial [Precursor]; Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial; L kynurenine/alpha aminoadipate aminotransferase;
Immunogens
Higher expression in the liver. Also found in heart, brain, kidney, pancreas, prostate, testis and ovary.
- Q8N5Z0 AADAT_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQLIKESL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q8N5Z0 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K31 | Acetylation | Uniprot | |
S32 | Phosphorylation | Uniprot | |
S35 | Phosphorylation | Uniprot | |
K49 | Acetylation | Uniprot | |
K69 | Acetylation | Uniprot | |
S176 | Phosphorylation | Uniprot | |
K367 | Ubiquitination | Uniprot |
Research Backgrounds
Transaminase with broad substrate specificity. Has transaminase activity towards aminoadipate, kynurenine, methionine and glutamate. Shows activity also towards tryptophan, aspartate and hydroxykynurenine. Accepts a variety of oxo-acids as amino-group acceptors, with a preference for 2-oxoglutarate, 2-oxocaproic acid, phenylpyruvate and alpha-oxo-gamma-methiol butyric acid. Can also use glyoxylate as amino-group acceptor (in vitro).
Mitochondrion.
Higher expression in the liver. Also found in heart, brain, kidney, pancreas, prostate, testis and ovary.
Homodimer.
Belongs to the class-I pyridoxal-phosphate-dependent aminotransferase family.
Research Fields
· Metabolism > Amino acid metabolism > Lysine degradation.
· Metabolism > Amino acid metabolism > Tryptophan metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
· Metabolism > Global and overview maps > 2-Oxocarboxylic acid metabolism.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.