SRP19 Antibody - #DF12753
Product: | SRP19 Antibody |
Catalog: | DF12753 |
Description: | Rabbit polyclonal antibody to SRP19 |
Application: | WB |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 20 kDa; 16kD(Calculated). |
Uniprot: | P09132 |
RRID: | AB_2845714 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12753, RRID:AB_2845714.
Immunogens
- P09132 SRP19_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNVFLEKNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKGKKKK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P09132 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S8 | Phosphorylation | Uniprot | |
R14 | Methylation | Uniprot | |
S38 | Phosphorylation | Uniprot | |
K102 | Ubiquitination | Uniprot | |
K121 | Ubiquitination | Uniprot | |
S135 | Phosphorylation | Uniprot |
Research Backgrounds
Signal-recognition-particle assembly, binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.
Cytoplasm.
Signal recognition particle consists of a 7S RNA molecule of 300 nucleotides and six protein subunits: SRP72, SRP68, SRP54, SRP19, SRP14 and SRP9.
Belongs to the SRP19 family.
Research Fields
· Genetic Information Processing > Folding, sorting and degradation > Protein export.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.