SPCS1 Antibody - #DF12750
| Product: | SPCS1 Antibody |
| Catalog: | DF12750 |
| Description: | Rabbit polyclonal antibody to SPCS1 |
| Application: | WB |
| Reactivity: | Human |
| Prediction: | Pig, Zebrafish, Bovine, Sheep, Rabbit, Dog, Chicken |
| Mol.Wt.: | 12 kDa; 18kD(Calculated). |
| Uniprot: | Q9Y6A9 |
| RRID: | AB_2845711 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12750, RRID:AB_2845711.
Fold/Unfold
HSPC033; Microsomal signal peptidase 12 kDa subunit; OTTHUMP00000206959; signal peptidase 12kDa; Signal peptidase complex subunit 1; signal peptidase complex subunit 1 homolog (S. cerevisiae); SPase 12 kDa subunit; SPC1; SPC12; SPCS1; SPCS1_HUMAN; YJR010C-A;
Immunogens
- Q9Y6A9 SPCS1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MARGGDTGCTGPSETSASGAAAIALPGLEGPATDAQCQTLPLTVLKSRSPSPRSLPPALSCPPPQPAMLEHLSSLPTQMDYKGQKLAEQMFQGIILFSAIVGFIYGYVAEQFGWTVYIVMAGFAFSCLLTLPPWPIYRRHPLKWLPVQESSTDDKKPGERKIKRHAKNN
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9Y6A9 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| Y14 | Phosphorylation | Uniprot | |
| K15 | Ubiquitination | Uniprot | |
| K18 | Ubiquitination | Uniprot | |
| K76 | Ubiquitination | Uniprot | |
| S83 | Phosphorylation | Uniprot | |
| S84 | Phosphorylation | Uniprot | |
| K89 | Ubiquitination | Uniprot | |
| K94 | Acetylation | Uniprot | |
| K100 | Acetylation | Uniprot |
Research Backgrounds
Component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.
(Microbial infection) Required for the post-translational processing of proteins involved in virion assembly and secretion from flaviviruses such as West Nile virus (WNV), Japanese encephalitis virus (JEV), Dengue virus type 2 (DENV-2), Yellow Fever virus (YFV), Zika virus (ZIKV) and hepatitis C virus (HCV). Plays a key role in the post-translational processing of flaviviral structural proteins prM, E, and NS1. In HCV, it is involved in virion assembly where it promotes the interaction between HCV virus proteins NS2 and E2.
Microsome membrane>Multi-pass membrane protein. Endoplasmic reticulum membrane>Multi-pass membrane protein.
Component of the microsomal signal peptidase complex which consists of five members: SEC11A, SEC11C, SPCS1, SPCS2 and SPCS3.
(Microbial infection) Interacts with hepatitis C virus (HCV) proteins NS2 and E2. Interacts with NS2B from Japanese encephalitis virus (JEV), West Nile virus (WNV), and Zika virus (ZIKV).
Belongs to the SPCS1 family.
Research Fields
· Genetic Information Processing > Folding, sorting and degradation > Protein export.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.