SDHB Antibody - #DF12732
Product: | SDHB Antibody |
Catalog: | DF12732 |
Description: | Rabbit polyclonal antibody to SDHB |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 32 kDa; 32kD(Calculated). |
Uniprot: | P21912 |
RRID: | AB_2845693 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12732, RRID:AB_2845693.
Fold/Unfold
CWS2; DHSB_HUMAN; FLJ92337; Ip; Iron sulfur subunit; Iron sulfur subunit of complex II; Iron-sulfur subunit of complex II; mitochondrial; PGL 4; PGL4; SDH 1; SDH; SDH1; SDH2; SDH2, homolog of; SdhB; SDHIP; Succinate dehydrogenase [ubiquinone] iron sulfur protein mitochondrial; Succinate dehydrogenase [ubiquinone] iron sulfur subunit; Succinate dehydrogenase [ubiquinone] iron-sulfur subunit; succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial; Succinate Dehydrogenase 1 Iron Sulfur Subunit; Succinate Dehydrogenase 2, S. cerevisiae, homolog of; Succinate dehydrogenase complex iron sulfur subunit B; Succinate dehydrogenase complex subunit B iron sulfur; Succinate Dehydrogenase Complex Subunit B Iron Sulfur Protein; succinate dehydrogenase complex, subunit B, iron sulfur (Ip); Succinate dehydrogenase iron sulfur protein;
Immunogens
- P21912 SDHB_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAAVVALSLRRRLPATTLGGACLQASRGAQTAAATAPRIKKFAIYRWDPDKAGDKPHMQTYEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKASV
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P21912 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K41 | Acetylation | Uniprot | |
K55 | Ubiquitination | Uniprot | |
C93 | S-Nitrosylation | Uniprot | |
C98 | S-Nitrosylation | Uniprot | |
C101 | S-Nitrosylation | Uniprot | |
C113 | S-Nitrosylation | Uniprot | |
T119 | Phosphorylation | Uniprot | |
K123 | Ubiquitination | Uniprot | |
K167 | Ubiquitination | Uniprot | |
Y216 | Phosphorylation | Uniprot | |
S222 | Phosphorylation | Uniprot | |
K233 | Ubiquitination | Uniprot | |
K267 | Ubiquitination | Uniprot |
Research Backgrounds
Iron-sulfur protein (IP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q).
Mitochondrion inner membrane>Peripheral membrane protein>Matrix side.
Component of complex II composed of four subunits: the flavoprotein (FP) SDHA, iron-sulfur protein (IP) SDHB, and a cytochrome b560 composed of SDHC and SDHD (By similarity). Interacts with SDHAF1; the interaction is required for iron-sulfur cluster incorporation into SDHB.
Belongs to the succinate dehydrogenase/fumarate reductase iron-sulfur protein family.
Research Fields
· Human Diseases > Endocrine and metabolic diseases > Non-alcoholic fatty liver disease (NAFLD).
· Human Diseases > Neurodegenerative diseases > Alzheimer's disease.
· Human Diseases > Neurodegenerative diseases > Parkinson's disease.
· Human Diseases > Neurodegenerative diseases > Huntington's disease.
· Metabolism > Carbohydrate metabolism > Citrate cycle (TCA cycle).
· Metabolism > Energy metabolism > Oxidative phosphorylation.
· Metabolism > Global and overview maps > Metabolic pathways.
· Metabolism > Global and overview maps > Carbon metabolism.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.