RNASEH2C Antibody - #DF12725
Product: | RNASEH2C Antibody |
Catalog: | DF12725 |
Description: | Rabbit polyclonal antibody to RNASEH2C |
Application: | WB IHC IF/ICC |
Reactivity: | Human |
Mol.Wt.: | 22 kDa; 18kD(Calculated). |
Uniprot: | Q8TDP1 |
RRID: | AB_2845686 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12725, RRID:AB_2845686.
Fold/Unfold
AGS3; Aicardi-Goutieres syndrome 3 protein; AYP1; Ribonuclease H2 subunit C; Ribonuclease HI subunit C; RNase H1 small subunit; RNASEH2C; RNH2C;
Immunogens
- Q8TDP1 RNH2C_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MESGDEAAIERHRVHLRSATLRDAVPATLHLLPCEVAVDGPAPVGRFFTPAIRQGPEGLEVSFRGRCLRGEEVAVPPGLVGYVMVTEEKKVSMGKPDPLRDSGTDDQEEEPLERDFDRFIGATANFSRFTLWGLETIPGPDAKVRGALTWPSLAAAIHAQVPED
PTMs - Q8TDP1 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
M1 | Acetylation | Uniprot | |
S3 | Phosphorylation | Uniprot | |
S62 | Phosphorylation | Uniprot | |
R64 | Methylation | Uniprot | |
S92 | Phosphorylation | Uniprot | |
S102 | Phosphorylation | Uniprot | |
R114 | Methylation | Uniprot | |
K143 | Sumoylation | Uniprot | |
K143 | Ubiquitination | Uniprot |
Research Backgrounds
Non catalytic subunit of RNase H2, an endonuclease that specifically degrades the RNA of RNA:DNA hybrids. Participates in DNA replication, possibly by mediating the removal of lagging-strand Okazaki fragment RNA primers during DNA replication. Mediates the excision of single ribonucleotides from DNA:RNA duplexes.
Nucleus.
Widely expressed.
The RNase H2 complex is a heterotrimer composed of the catalytic subunit RNASEH2A and the non-catalytic subunits RNASEH2B and RNASEH2C.
Belongs to the RNase H2 subunit C family.
Research Fields
· Genetic Information Processing > Replication and repair > DNA replication.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.