Product: RMI1 Antibody
Catalog: DF12724
Description: Rabbit polyclonal antibody to RMI1
Application: WB
Reactivity: Human
Mol.Wt.: 75 kDa; 70kD(Calculated).
Uniprot: Q9H9A7
RRID: AB_2845685

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Polyclonal
Specificity:
RMI1 Antibody detects endogenous levels of total RMI1.
RRID:
AB_2845685
Cite Format: Affinity Biosciences Cat# DF12724, RRID:AB_2845685.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

BLAP75; BLM associated polypeptide 75 kDa; BLM associated protein 75 kDa; BLM-associated protein of 75 kDa; C9orf76; FAAP75; FLJ12888; Homolog of yeast RecQ mediated genome instability 1; RecQ mediated genome instability 1; RecQ-mediated genome instability protein 1; Rmi1; RMI1 homolog; RMI1 RecQ mediated genome instability 1 homolog; RMI1_HUMAN; RP11-346I8;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Sequence:
MNVTSIALRAETWLLAAWHVKVPPMWLEACINWIQEENNNVNLSQAQMNKQVFEQWLLTDLRDLEHPLLPDGILEIPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKNTTNDLVTAEAQVTPKPWEAKPSRMLMLQLTDGIVQIQGMEYQPIPILHSDLPPGTKILIYGNISFRLGVLLLKPENVKVLGGEVDALLEEYAQEKVLARLIGEPDLVVSVIPNNSNENIPRVTDVLDPALGPSDEELLASLDENDELTANNDTSSERCFTTGSSSNTIPTRQSSFEPEFVISPRPKEEPSNLSIHVMDGELDDFSLEEALLLEETVQKEQMETKELQPLTFNRNADRSIERFSHNPNTTNNFSLTCKNGNNNWSEKNVSEQMTNEDKSFGCPSVRDQNRSIFSVHCNVPLAHDFTNKEKNLETDNKIKQTSSSDSHSLNNKILNREVVNYVQKRNSQISNENDCNLQSCSLRSSENSINLSIAMDLYSPPFVYLSVLMASKPKEVTTVKVKAFIVTLTGNLSSSGGIWSITAKVSDGTAYLDVDFVDEILTSLIGFSVPEMKQSKKDPLQYQKFLEGLQKCQRDLIDLCCLMTISFNPSLSKAMVLALQDVNMEHLENLKKRLNK

PTMs - Q9H9A7 As Substrate

Site PTM Type Enzyme
M1 Acetylation
T4 Phosphorylation
K109 Ubiquitination
T111 Phosphorylation
T112 Phosphorylation
T123 Phosphorylation
K125 Ubiquitination
K130 Ubiquitination
S132 Phosphorylation
K205 Ubiquitination
S219 Phosphorylation
S225 Phosphorylation
S250 Phosphorylation
T277 Phosphorylation
T280 Phosphorylation
S283 Phosphorylation
S284 Phosphorylation
S292 Phosphorylation
K334 Sumoylation
K334 Ubiquitination
T359 Phosphorylation
S363 Phosphorylation
K376 Ubiquitination
T383 Phosphorylation
K387 Ubiquitination
S388 Phosphorylation
S400 Phosphorylation
S403 Phosphorylation
T415 Phosphorylation
K428 Ubiquitination
K441 Ubiquitination
Y450 Phosphorylation
K453 Ubiquitination
S456 Phosphorylation
S524 Phosphorylation
K566 Ubiquitination
K573 Ubiquitination
K580 Ubiquitination

Research Backgrounds

Function:

Essential component of the RMI complex, a complex that plays an important role in the processing of homologous recombination intermediates to limit DNA crossover formation in cells. Promotes TOP3A binding to double Holliday junctions (DHJ) and hence stimulates TOP3A-mediated dissolution. Required for BLM phosphorylation during mitosis. Within the BLM complex, required for BLM and TOP3A stability.

Subcellular Location:

Nucleus.
Note: Forms foci in response to DNA damage.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Component of the RMI complex, containing at least TOP3A, RMI1 and RMI2. The RMI complex interacts with BLM. Directly interacts with RMI2 and TOP3A. May bind DHJ. Interacts (via N-terminal region) with BLM; the interaction is direct.

Family&Domains:

Belongs to the RMI1 family.

Research Fields

· Genetic Information Processing > Replication and repair > Fanconi anemia pathway.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.