RMI1 Antibody - #DF12724
Product: | RMI1 Antibody |
Catalog: | DF12724 |
Description: | Rabbit polyclonal antibody to RMI1 |
Application: | WB |
Reactivity: | Human |
Mol.Wt.: | 75 kDa; 70kD(Calculated). |
Uniprot: | Q9H9A7 |
RRID: | AB_2845685 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12724, RRID:AB_2845685.
Fold/Unfold
BLAP75; BLM associated polypeptide 75 kDa; BLM associated protein 75 kDa; BLM-associated protein of 75 kDa; C9orf76; FAAP75; FLJ12888; Homolog of yeast RecQ mediated genome instability 1; RecQ mediated genome instability 1; RecQ-mediated genome instability protein 1; Rmi1; RMI1 homolog; RMI1 RecQ mediated genome instability 1 homolog; RMI1_HUMAN; RP11-346I8;
Immunogens
- Q9H9A7 RMI1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MNVTSIALRAETWLLAAWHVKVPPMWLEACINWIQEENNNVNLSQAQMNKQVFEQWLLTDLRDLEHPLLPDGILEIPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKNTTNDLVTAEAQVTPKPWEAKPSRMLMLQLTDGIVQIQGMEYQPIPILHSDLPPGTKILIYGNISFRLGVLLLKPENVKVLGGEVDALLEEYAQEKVLARLIGEPDLVVSVIPNNSNENIPRVTDVLDPALGPSDEELLASLDENDELTANNDTSSERCFTTGSSSNTIPTRQSSFEPEFVISPRPKEEPSNLSIHVMDGELDDFSLEEALLLEETVQKEQMETKELQPLTFNRNADRSIERFSHNPNTTNNFSLTCKNGNNNWSEKNVSEQMTNEDKSFGCPSVRDQNRSIFSVHCNVPLAHDFTNKEKNLETDNKIKQTSSSDSHSLNNKILNREVVNYVQKRNSQISNENDCNLQSCSLRSSENSINLSIAMDLYSPPFVYLSVLMASKPKEVTTVKVKAFIVTLTGNLSSSGGIWSITAKVSDGTAYLDVDFVDEILTSLIGFSVPEMKQSKKDPLQYQKFLEGLQKCQRDLIDLCCLMTISFNPSLSKAMVLALQDVNMEHLENLKKRLNK
PTMs - Q9H9A7 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
M1 | Acetylation | Uniprot | |
T4 | Phosphorylation | Uniprot | |
K109 | Ubiquitination | Uniprot | |
T111 | Phosphorylation | Uniprot | |
T112 | Phosphorylation | Uniprot | |
T123 | Phosphorylation | Uniprot | |
K125 | Ubiquitination | Uniprot | |
K130 | Ubiquitination | Uniprot | |
S132 | Phosphorylation | Uniprot | |
K205 | Ubiquitination | Uniprot | |
S219 | Phosphorylation | Uniprot | |
S225 | Phosphorylation | Uniprot | |
S250 | Phosphorylation | Uniprot | |
T277 | Phosphorylation | Uniprot | |
T280 | Phosphorylation | Uniprot | |
S283 | Phosphorylation | Uniprot | |
S284 | Phosphorylation | Uniprot | |
S292 | Phosphorylation | Uniprot | |
K334 | Sumoylation | Uniprot | |
K334 | Ubiquitination | Uniprot | |
T359 | Phosphorylation | Uniprot | |
S363 | Phosphorylation | Uniprot | |
K376 | Ubiquitination | Uniprot | |
T383 | Phosphorylation | Uniprot | |
K387 | Ubiquitination | Uniprot | |
S388 | Phosphorylation | Uniprot | |
S400 | Phosphorylation | Uniprot | |
S403 | Phosphorylation | Uniprot | |
T415 | Phosphorylation | Uniprot | |
K428 | Ubiquitination | Uniprot | |
K441 | Ubiquitination | Uniprot | |
Y450 | Phosphorylation | Uniprot | |
K453 | Ubiquitination | Uniprot | |
S456 | Phosphorylation | Uniprot | |
S524 | Phosphorylation | Uniprot | |
K566 | Ubiquitination | Uniprot | |
K573 | Ubiquitination | Uniprot | |
K580 | Ubiquitination | Uniprot |
Research Backgrounds
Essential component of the RMI complex, a complex that plays an important role in the processing of homologous recombination intermediates to limit DNA crossover formation in cells. Promotes TOP3A binding to double Holliday junctions (DHJ) and hence stimulates TOP3A-mediated dissolution. Required for BLM phosphorylation during mitosis. Within the BLM complex, required for BLM and TOP3A stability.
Nucleus.
Note: Forms foci in response to DNA damage.
Component of the RMI complex, containing at least TOP3A, RMI1 and RMI2. The RMI complex interacts with BLM. Directly interacts with RMI2 and TOP3A. May bind DHJ. Interacts (via N-terminal region) with BLM; the interaction is direct.
Belongs to the RMI1 family.
Research Fields
· Genetic Information Processing > Replication and repair > Fanconi anemia pathway.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.