PSPH Antibody - #DF12711
Product: | PSPH Antibody |
Catalog: | DF12711 |
Description: | Rabbit polyclonal antibody to PSPH |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 25 kDa; 25kD(Calculated). |
Uniprot: | P78330 |
RRID: | AB_2845672 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12711, RRID:AB_2845672.
Fold/Unfold
EC 3.1.3.3; L 3 phosphoserine phosphatase; L-3-phosphoserine phosphatase; O phosphoserine phosphohydrolase; O-phosphoserine phosphohydrolase; Phosphoserine phosphatase; Phosphoserine phosphatase deficiency, included; PSP; PSPase; Psph; PSPHD; SERB_HUMAN;
Immunogens
- P78330 SERB_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEE
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P78330 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
M1 | Acetylation | Uniprot | |
K59 | Methylation | Uniprot | |
T88 | Phosphorylation | Uniprot | |
K158 | Ubiquitination | Uniprot |
Research Backgrounds
Catalyzes the last step in the biosynthesis of serine from carbohydrates. The reaction mechanism proceeds via the formation of a phosphoryl-enzyme intermediates.
Homodimer.
Belongs to the HAD-like hydrolase superfamily. SerB family.
Research Fields
· Metabolism > Amino acid metabolism > Glycine, serine and threonine metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
· Metabolism > Global and overview maps > Carbon metabolism.
· Metabolism > Global and overview maps > Biosynthesis of amino acids.
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.