Nurr1/NR4A2 Antibody - #DF12678
| Product: | Nurr1/NR4A2 Antibody |
| Catalog: | DF12678 |
| Description: | Rabbit polyclonal antibody to Nurr1/NR4A2 |
| Application: | WB |
| Reactivity: | Human |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 66 kDa; 67kD(Calculated). |
| Uniprot: | P43354 |
| RRID: | AB_2845640 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12678, RRID:AB_2845640.
Fold/Unfold
HZF 3; HZF3; Immediate-early response protein NOT; Intermediate early receptor protein; NGFI B/nur77 beta type transcription factor homolog; NOT; Nr4a2; NR4A2_HUMAN; nuclear receptor of T cells; nuclear receptor related 1; Nuclear receptor subfamily 4 group A member 2; Nur related protein 1 homolog; nur related protein-1, human homolog of; Nurr 1; Orphan nuclear receptor NR4A2; Orphan nuclear receptor NURR1; RNR 1; RNR1; T cell nuclear receptor NOT; T-cell nuclear receptor NOT; TINUR; Transcriptionally inducible nuclear receptor; Transcriptionally inducible nuclear receptor related; Transcriptionally inducible nuclear receptor related 1; Transcriptionally-inducible nuclear receptor;
Immunogens
Expressed in a number of cell lines of T-cell, B-cell and fibroblast origin. Strong expression in brain tissue.
- P43354 NR4A2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPCVQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSFSTFMDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSVYYKPSSPPTPTTPGFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQSPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFPGLQIGHASQLLDTQVPSPPSRGSPSNEGLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKSPQEPSPPSPPVSLISALVRAHVDSNPAMTSLDYSRFQANPDYQMSGDDTQHIQQFYDLLTGSMEIIRGWAEKIPGFADLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFGEWIDSIVEFSSNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHVTFNNGGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P43354 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| Y71 | Phosphorylation | Uniprot | |
| S125 | Phosphorylation | Uniprot | |
| S126 | Phosphorylation | P28482 (MAPK1) | Uniprot |
| T129 | Phosphorylation | Uniprot | |
| T132 | Phosphorylation | P28482 (MAPK1) | Uniprot |
| S177 | Phosphorylation | Uniprot | |
| S181 | Phosphorylation | Uniprot | |
| T185 | Phosphorylation | Uniprot | |
| K226 | Ubiquitination | Uniprot | |
| S250 | Phosphorylation | Uniprot | |
| S256 | Phosphorylation | Uniprot | |
| S258 | Phosphorylation | Uniprot | |
| Y275 | Phosphorylation | Uniprot | |
| T279 | Phosphorylation | Uniprot | |
| K296 | Ubiquitination | Uniprot | |
| K303 | Ubiquitination | Uniprot | |
| T335 | Phosphorylation | Uniprot | |
| S337 | Phosphorylation | P78527 (PRKDC) | Uniprot |
| S347 | Phosphorylation | Uniprot | |
| S351 | Phosphorylation | Uniprot | |
| S356 | Phosphorylation | Uniprot | |
| S359 | Phosphorylation | Uniprot | |
| S363 | Phosphorylation | Uniprot | |
| K530 | Ubiquitination | Uniprot | |
| K558 | Sumoylation | Uniprot | |
| K558 | Ubiquitination | Uniprot | |
| K577 | Sumoylation | Uniprot |
Research Backgrounds
Transcriptional regulator which is important for the differentiation and maintenance of meso-diencephalic dopaminergic (mdDA) neurons during development. It is crucial for expression of a set of genes such as SLC6A3, SLC18A2, TH and DRD2 which are essential for development of mdDA neurons (By similarity).
Cytoplasm. Nucleus.
Note: Mostly nuclear; oxidative stress promotes cytoplasmic localization.
Expressed in a number of cell lines of T-cell, B-cell and fibroblast origin. Strong expression in brain tissue.
Interacts with SFPQ, NCOR2, SIN3A and HADC1. The interaction with NCOR2 increases in the absence of PITX3. Interacts with PER2 (By similarity).
the ligand-binding domain (LBD) contains no cavity as a result of the tight packing of side chains from several bulky hydrophobic residues in the region normally occupied by ligands. NR4A2 lacks a 'classical' binding site for coactivators (PubMed:12774125).
Belongs to the nuclear hormone receptor family. NR4 subfamily.
Research Fields
· Organismal Systems > Endocrine system > Aldosterone synthesis and secretion.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.