NHP2 Antibody - #DF12670
| Product: | NHP2 Antibody |
| Catalog: | DF12670 |
| Description: | Rabbit polyclonal antibody to NHP2 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 17 kDa; 17kD(Calculated). |
| Uniprot: | Q9NX24 |
| RRID: | AB_2845632 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12670, RRID:AB_2845632.
Fold/Unfold
DKCB2; FLJ20479; H/ACA ribonucleoprotein complex subunit 2; NHP2; NHP2 like protein; NHP2 ribonucleoprotein; NHP2 ribonucleoprotein homolog (yeast) 1; NHP2 ribonucleoprotein homolog; NHP2, S. cerevisiae, homolog of; NHP2_HUMAN; NHP2P; NOLA2; Nucleolar protein family A member 2 (H/ACA small nucleolar RNPs); Nucleolar protein family A member 2; snoRNP protein NHP2;
Immunogens
Expressed in brain, colon, heart, kidney, ovary, pancreas, placenta, prostate, skeletal muscle, small intestine, spleen, testis and thymus. Also expressed at lower levels in the liver.
- Q9NX24 NHP2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTKIKADPDGPEAQAEACSGERTYQELLVNQNPIAQPLASRRLTRKLYKCIKKAVKQKQIRRGVKEVQKFVNKGEKGIMVLAGDTLPIEVYCHLPVMCEDRNLPYVYIPSKTDLGAAAGSKRPTCVIMVKPHEEYQEAYDECLEEVQSLPLPL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9NX24 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K5 | Acetylation | Uniprot | |
| K5 | Sumoylation | Uniprot | |
| K5 | Ubiquitination | Uniprot | |
| C18 | S-Nitrosylation | Uniprot | |
| S19 | Phosphorylation | Uniprot | |
| Y48 | Phosphorylation | Uniprot | |
| K69 | Ubiquitination | Uniprot | |
| K73 | Ubiquitination | Uniprot | |
| K111 | Ubiquitination | Uniprot | |
| K121 | Ubiquitination | Uniprot |
Research Backgrounds
Required for ribosome biogenesis and telomere maintenance. Part of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP) complex, which catalyzes pseudouridylation of rRNA. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Each rRNA can contain up to 100 pseudouridine ('psi') residues, which may serve to stabilize the conformation of rRNAs. May also be required for correct processing or intranuclear trafficking of TERC, the RNA component of the telomerase reverse transcriptase (TERT) holoenzyme.
Nucleus>Nucleolus. Nucleus>Cajal body.
Note: Also localized to Cajal bodies (coiled bodies).
Expressed in brain, colon, heart, kidney, ovary, pancreas, placenta, prostate, skeletal muscle, small intestine, spleen, testis and thymus. Also expressed at lower levels in the liver.
Part of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP) complex, which contains NHP2/NOLA2, GAR1/NOLA1, NOP10/NOLA3, and DKC1/NOLA4, which is presumed to be the catalytic subunit. The complex contains a stable core formed by binding of one or two NOP10-DKC1 heterodimers to NHP2; GAR1 subsequently binds to this core via DKC1. The complex binds a box H/ACA small nucleolar RNA (snoRNA), which may target the specific site of modification within the RNA substrate. During assembly, the complex contains NAF1 instead of GAR1/NOLA1. The complex also interacts with TERC, which contains a 3'-terminal domain related to the box H/ACA snoRNAs. Specific interactions with snoRNAs or TERC are mediated by GAR1 and NHP2. Associates with NOLC1/NOPP140. H/ACA snoRNPs interact with the SMN complex, consisting of SMN1 or SMN2, GEMIN2/SIP1, DDX20/GEMIN3, and GEMIN4. This is mediated by interaction between GAR1 and SMN1 or SMN2. The SMN complex may be required for correct assembly of the H/ACA snoRNP complex. Component of the telomerase holoenzyme complex composed of one molecule of TERT, one molecule of WRAP53/TCAB1, two molecules of H/ACA ribonucleoprotein complex subunits DKC1, NOP10, NHP2 and GAR1, and a telomerase RNA template component (TERC). The telomerase holoenzyme complex is associated with TEP1, SMG6/EST1A and POT1.
Belongs to the eukaryotic ribosomal protein eL8 family.
Research Fields
· Genetic Information Processing > Translation > Ribosome biogenesis in eukaryotes.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.