HSP27 Antibody | Affinity Biosciences

Cites

1/2

FIGURE 6 | Effects of HQT-medicated serum on amount of phosphorylated HSP27 and total HSP27 (A,B) and phosphorylation level of HSP27 (A,C) in FFA-stimulated L02 hepatocytes over 24 h.

Figure 4 - DPSC-Exos promote angiogenesis via p38 MAPK to promote wound healing.

Product:	HSP27 Antibody
Catalog:	AF6082
Description:	Rabbit polyclonal antibody to HSP27
Application:	WB IHC IF/ICC
Reactivity:	Human, Mouse, Rat
Prediction:	Pig, Zebrafish, Bovine, Horse, Rabbit, Dog, Xenopus
Mol.Wt.:	27kDa; 23kD(Calculated).
Uniprot:	P04792
RRID:	AB_2834851

View similar products>>

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific.

Size	Price	Inventory
100ul	$280	In stock
200ul	$350	In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Related Downloads

MSDS

Data Sheet

COA

Protocols

WB Handbook

IHC Protocol

IF/ICC Protocol

Product Info

Source:

Rabbit

Application:

WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:

Human,Mouse,Rat

Prediction:

Pig(91%), Zebrafish(91%), Bovine(100%), Horse(100%), Rabbit(100%), Dog(100%), Xenopus(91%)

Clonality:

Polyclonal

Specificity:

HSP27 Antibody detects endogenous levels of total HSP27.

RRID:

AB_2834851
Cite Format: Affinity Biosciences Cat# AF6082, RRID:AB_2834851.

Conjugate:

Unconjugated.

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Storage:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.

Alias:

Fold/Unfold

Heat shock 27kDa protein; 28 kDa heat shock protein; CMT2F; DKFZp586P1322; epididymis secretory protein Li 102; Estrogen regulated 24 kDa protein; Estrogen-regulated 24 kDa protein; Heat shock 25kDa protein 1; Heat shock 27 kDa protein; Heat shock 27kD protein 1; Heat shock 27kDa protein 1; Heat shock 28kDa protein 1; Heat Shock Protein 27; Heat shock protein beta 1; Heat shock protein beta-1; heat shock protein family B (small) member 1; HEL-S-102; HMN2B; HS.76067; Hsp 25; HSP 27; Hsp 28; Hsp B1; Hsp25; HSP27; Hsp28; HspB1; HSPB1_HUMAN; SRP27; Stress responsive protein 27; Stress-responsive protein 27;

Immunogens

Immunogen:

Uniprot:

P04792(HSPB1_HUMAN) >>Visit HPA database.

Gene(ID):

HSPB1(3315)

Expression:

P04792 HSPB1_HUMAN:

Detected in all tissues tested: skeletal muscle, heart, aorta, large intestine, small intestine, stomach, esophagus, bladder, adrenal gland, thyroid, pancreas, testis, adipose tissue, kidney, liver, spleen, cerebral cortex, blood serum and cerebrospinal fluid. Highest levels are found in the heart and in tissues composed of striated and smooth muscle.

Description:

HSP27 is a small heat shock protein that is regulated both transcriptionally and posttranslationally. Modulates actin polymerization and reorganization.

Sequence:

P04792 HSPB1_HUMAN:
Protein BLAST With
NCBI/
ExPASy/
Uniprot

MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species

Results

Score

Horse

100

Bovine

100

Dog

100

Rabbit

100

Pig

Xenopus

Zebrafish

Sheep

Chicken

Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P04792 As Substrate

P04792

Site	PTM Type	Enzyme	Source
R5	Methylation		Uniprot
S9	Phosphorylation		Uniprot
R12	Methylation		Uniprot
S15	Phosphorylation	P49137 (MAPKAPK2) , Q05655 (PRKCD) , Q8IW41 (MAPKAPK5) , Q13976-2 (PRKG1) , Q16644 (MAPKAPK3) , P23443 (RPS6KB1)	Uniprot
Y23	Phosphorylation		Uniprot
S26	Phosphorylation		Uniprot
R37	Methylation		Uniprot
Y54	Phosphorylation		Uniprot
R56	Methylation		Uniprot
S65	Phosphorylation		Uniprot
Y73	Phosphorylation		Uniprot
S74	Phosphorylation		Uniprot
S78	Phosphorylation	Q13237 (PRKG2) , Q13976 (PRKG1) , P23443 (RPS6KB1) , P17612 (PRKACA) , Q9UBS0 (RPS6KB2) , Q16644 (MAPKAPK3) , P49137 (MAPKAPK2) , Q8IW41 (MAPKAPK5) , P51812 (RPS6KA3)	Uniprot
S82	Phosphorylation	P23443 (RPS6KB1) , P17612 (PRKACA) , Q8IW41 (MAPKAPK5) , P51812 (RPS6KA3) , P98161 (PKD1) , P49137 (MAPKAPK2) , Q9Y243 (AKT3) , Q9UBS0 (RPS6KB2) , Q13976 (PRKG1) , Q13237 (PRKG2) , P31751 (AKT2) , P31749 (AKT1) , Q16644 (MAPKAPK3) , Q15139 (PRKD1)	Uniprot
S83	Phosphorylation		Uniprot
S86	Phosphorylation	Q05655 (PRKCD)	Uniprot
R89	Methylation		Uniprot
T91	Phosphorylation		Uniprot
S98	Phosphorylation		Uniprot
T110	Phosphorylation		Uniprot
K112	Ubiquitination		Uniprot
T113	Phosphorylation		Uniprot
K114	Sumoylation		Uniprot
K114	Ubiquitination		Uniprot
T121	Phosphorylation		Uniprot
K123	Acetylation		Uniprot
K123	Ubiquitination		Uniprot
Y133	Phosphorylation		Uniprot
S135	Phosphorylation		Uniprot
T139	Phosphorylation		Uniprot
K141	Ubiquitination		Uniprot
Y142	Phosphorylation		Uniprot
T143	Phosphorylation	P17612 (PRKACA) , Q13976 (PRKG1) , Q13237 (PRKG2)	Uniprot
T162	Phosphorylation		Uniprot
T164	Phosphorylation		Uniprot
K171	Ubiquitination		Uniprot
T174	Phosphorylation		Uniprot
S176	Phosphorylation	Q16539 (MAPK14)	Uniprot
T180	Phosphorylation		Uniprot
T184	Phosphorylation		Uniprot
S187	Phosphorylation		Uniprot
K198	Sumoylation		Uniprot
K198	Ubiquitination		Uniprot
S199	Phosphorylation		Uniprot
T202	Phosphorylation		Uniprot
K205	Acetylation		Uniprot
K205	Ubiquitination		Uniprot

Research Backgrounds

P04792_HSPB1_HUMAN

Function:

Small heat shock protein which functions as a molecular chaperone probably maintaining denatured proteins in a folding-competent state. Plays a role in stress resistance and actin organization. Through its molecular chaperone activity may regulate numerous biological processes including the phosphorylation and the axonal transport of neurofilament proteins.

PTMs:

Phosphorylated upon exposure to protein kinase C activators and heat shock. Phosphorylation by MAPKAPK2 and MAPKAPK3 in response to stress dissociates HSPB1 from large small heat-shock protein (sHsps) oligomers and impairs its chaperone activity and ability to protect against oxidative stress effectively. Phosphorylation by MAPKAPK5 in response to PKA stimulation induces F-actin rearrangement.

Subcellular Location:

Cytoplasm. Nucleus. Cytoplasm>Cytoskeleton>Spindle.
Note: Cytoplasmic in interphase cells. Colocalizes with mitotic spindles in mitotic cells. Translocates to the nucleus during heat shock and resides in sub-nuclear structures known as SC35 speckles or nuclear splicing speckles.

Tissue Specificity:

Subunit Structure:

Homooligomer. Homodimer; becomes monomeric upon activation. Heterooligomer; with HSPB6. Associates with alpha- and beta-tubulin. Interacts with TGFB1I1 (By similarity). Interacts with CRYAB. Interacts with HSPB8. Interacts with HSPBAP1.

Family&Domains:

Belongs to the small heat shock protein (HSP20) family.

Research Fields

· Environmental Information Processing > Signal transduction > MAPK signaling pathway. (View pathway)

· Human Diseases > Infectious diseases: Parasitic > Amoebiasis.

· Human Diseases > Infectious diseases: Viral > Epstein-Barr virus infection.

References

1). Isobaric Tags for Relative and Absolute Quantitation (iTRAQ)-Based Proteomic Analysis of Hugan Qingzhi and Its Protective Properties against Free Fatty Acid-Induced L02 Hepatocyte Injury. Frontiers in Pharmacology, 2017 (PubMed: 28293193) [IF=5.6]

Application: WB Species: human Sample:

FIGURE 6 | Effects of HQT-medicated serum on amount of phosphorylated HSP27 and total HSP27 (A,B) and phosphorylation level of HSP27 (A,C) in FFA-stimulated L02 hepatocytes over 24 h. GAPDH was used as a loading control. Values are expressed as mean ± SD in each group. ∗∗p < 0.01 vs. control group; ##p < 0.01 vs. FFA group.

2). Exosomes derived from dental pulp stem cells accelerate cutaneous wound healing by enhancing angiogenesis via the Cdc42/p38 MAPK pathway. International Journal of Molecular Medicine, 2022 (PubMed: 36321793) [IF=5.4]

Application: WB Species: Human Sample:

Figure 4 - DPSC-Exos promote angiogenesis via p38 MAPK to promote wound healing. (A and B) HUVECs were treated with DPSC-Exos in the presence or absence of SB203580. The expression of p38, p-p38, hsp27 and p-hsp27 was detected using western blot analysis (n=3). (C and D) The migration of HUVECs stimulated by DPSC-Exos or an equal volume of PBS in the presence or absence of SB203580 (n=3). Scale bar, 100 µm. (E and F) Representative images of scratch wound assay in HUVECs treated with DPSC-Exos or PBS in the presence or absence of SB203580 (n=3). Scale bar, 100 µm. (G) The proliferation of HUVECs receiving different treatments were examined using CCK-8 assay (n=3). (H-J) Representative images of the tube formation assay on Matrigel in HUVECs treated with DPSC-Exos or PBS (n=3). Scale bar, 100 µm. *P

3). Novel methyltransferase G9a inhibitor induces ferroptosis in multiple myeloma through Nrf2/HO-1 pathway. Annals of hematology, 2024 (PubMed: 38538975) [IF=3.5]

4). A Group of Complexes Based on PAMAM and Quantum Dots Used in Clinical Immunoassays. Nanoscale Research Letters, 2020 (PubMed: 32246298)

Restrictive clause

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.

HSP27 Antibody - #AF6082