LAP3 Antibody - #DF12651
| Product: | LAP3 Antibody |
| Catalog: | DF12651 |
| Description: | Rabbit polyclonal antibody to LAP3 |
| Application: | WB |
| Cited expt.: | WB |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 56 kDa; 56kD(Calculated). |
| Uniprot: | P28838 |
| RRID: | AB_2845613 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12651, RRID:AB_2845613.
Fold/Unfold
AMPL_HUMAN; Cytosol aminopeptidase; epididymis secretory protein Li 106; HEL-S-106; LAP 3; LAP; LAP-3; Lap3; LAPEP; Leucine aminopeptidase 3; Leucyl aminopeptidase; PEPS; Peptidase S; Proline aminopeptidase; Prolyl aminopeptidase;
Immunogens
A synthesized peptide derived from human LAP3, corresponding to a region within the internal amino acids.
- P28838 AMPL_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MFLLPLPAAGRVVVRRLAVRRFGSRSLSTADMTKGLVLGIYSKEKEDDVPQFTSAGENFDKLLAGKLRETLNISGPPLKAGKTRTFYGLHQDFPSVVLVGLGKKAAGIDEQENWHEGKENIRAAVAAGCRQIQDLELSSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKKKMAVSAKLYGSGDQEAWQKGVLFASGQNLARQLMETPANEMTPTRFAEIIEKNLKSASSKTEVHIRPKSWIEEQAMGSFLSVAKGSDEPPVFLEIHYKGSPNANEPPLVFVGKGITFDSGGISIKASANMDLMRADMGGAATICSAIVSAAKLNLPINIIGLAPLCENMPSGKANKPGDVVRAKNGKTIQVDNTDAEGRLILADALCYAHTFNPKVILNAATLTGAMDVALGSGATGVFTNSSWLWNKLFEASIETGDRVWRMPLFEHYTRQVVDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKDEVPYLRKGMTGRPTRTLIEFLLRFSQDNA
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Presumably involved in the processing and regular turnover of intracellular proteins. Catalyzes the removal of unsubstituted N-terminal amino acids from various peptides.
Cytoplasm.
Belongs to the peptidase M17 family.
Research Fields
· Metabolism > Amino acid metabolism > Arginine and proline metabolism.
· Metabolism > Metabolism of other amino acids > Glutathione metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
References
Application: WB Species: Human Sample: BMECs
Application: IHC Species: Human Sample: breast cancer cell
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.