IRF1 Antibody - #DF12645
Product: | IRF1 Antibody |
Catalog: | DF12645 |
Description: | Rabbit polyclonal antibody to IRF1 |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
Mol.Wt.: | 50 kDa; 37kD(Calculated). |
Uniprot: | P10914 |
RRID: | AB_2845607 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12645, RRID:AB_2845607.
Fold/Unfold
Interferon regulatory factor 1; Interferon regulatory factor 1 isoform +I9; Interferon regulatory factor 1 isoform d78; Interferon regulatory factor 1 isoform delta4; Interferon regulatory factor 1 isoform delta7; IRF 1; IRF-1; IRF1; IRF1_HUMAN; MAR; MAR1;
Immunogens
- P10914 IRF1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTKNQRKERKSKSSRDAKSKAKRKSCGDSSPDTFSDGLSSSTLPDDHSSYTVPGYMQDLEVEQALTPALSPCAVSSTLPDWHIPVEVVPDSTSDLYNFQVSPMPSTSEATTDEDEEGKLPEDIMKLLEQSEWQPTNVDGKGYLLNEPGVQPTSVYGDFSCKEEPEIDSPGGDIGLSLQRVFTDLKNMDATWLDSLLTPVRLPSIQAIPCAP
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P10914 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K39 | Ubiquitination | Uniprot | |
K43 | Ubiquitination | Uniprot | |
K50 | Ubiquitination | Uniprot | |
T62 | Phosphorylation | Uniprot | |
Y65 | Phosphorylation | Uniprot | |
T76 | Phosphorylation | Uniprot | |
K78 | Acetylation | Uniprot | |
K78 | Sumoylation | Uniprot | |
K78 | Ubiquitination | Uniprot | |
K95 | Ubiquitination | Uniprot | |
Y109 | Phosphorylation | Uniprot | |
K117 | Ubiquitination | Uniprot | |
K126 | Methylation | Uniprot | |
S215 | Phosphorylation | Q14164 (IKBKE) | Uniprot |
S219 | Phosphorylation | Q14164 (IKBKE) | Uniprot |
S221 | Phosphorylation | Q14164 (IKBKE) | Uniprot |
K254 | Ubiquitination | Uniprot | |
K275 | Sumoylation | Uniprot | |
K275 | Ubiquitination | Uniprot | |
S282 | Phosphorylation | Uniprot | |
K299 | Sumoylation | Uniprot | |
K299 | Ubiquitination | Uniprot |
Research Backgrounds
Transcriptional regulator which displays a remarkable functional diversity in the regulation of cellular responses. These include the regulation of IFN and IFN-inducible genes, host response to viral and bacterial infections, regulation of many genes expressed during hematopoiesis, inflammation, immune responses and cell proliferation and differentiation, regulation of the cell cycle and induction of growth arrest and programmed cell death following DNA damage. Stimulates both innate and acquired immune responses through the activation of specific target genes and can act as a transcriptional activator and repressor regulating target genes by binding to an interferon-stimulated response element (ISRE) in their promoters. Its target genes for transcriptional activation activity include: genes involved in anti-viral response, such as IFN-alpha/beta, DDX58/RIG-I, TNFSF10/TRAIL, OAS1/2, PIAS1/GBP, EIF2AK2/PKR and RSAD2/viperin; antibacterial response, such as NOS2/INOS; anti-proliferative response, such as p53/TP53, LOX and CDKN1A; apoptosis, such as BBC3/PUMA, CASP1, CASP7 and CASP8; immune response, such as IL7, IL12A/B and IL15, PTGS2/COX2 and CYBB; DNA damage responses and DNA repair, such as POLQ/POLH; MHC class I expression, such as TAP1, PSMB9/LMP2, PSME1/PA28A, PSME2/PA28B and B2M and MHC class II expression, such as CIITA. Represses genes involved in anti-proliferative response, such as BIRC5/survivin, CCNB1, CCNE1, CDK1, CDK2 and CDK4 and in immune response, such as FOXP3, IL4, ANXA2 and TLR4. Stimulates p53/TP53-dependent transcription through enhanced recruitment of EP300 leading to increased acetylation of p53/TP53. Plays an important role in immune response directly affecting NK maturation and activity, macrophage production of IL12, Th1 development and maturation of CD8+ T-cells. Also implicated in the differentiation and maturation of dendritic cells and in the suppression of regulatory T (Treg) cells development. Acts as a tumor suppressor and plays a role not only in antagonism of tumor cell growth but also in stimulating an immune response against tumor cells.
Phosphorylated by CK2 and this positively regulates its activity.
Sumoylation represses the transcriptional activity and displays enhanced resistance to protein degradation. Inactivates the tumor suppressor activity. Elevated levels in tumor cells. Major site is Lys-275. Sumoylation is enhanced by PIAS3 (By similarity). Desumoylated by SENP1 in tumor cells and appears to compete with ubiquitination on C-terminal sites.
Ubiquitinated. Appears to compete with sumoylation on C-terminal sites.
Nucleus. Cytoplasm.
Note: MYD88-associated IRF1 migrates into the nucleus more efficiently than non-MYD88-associated IRF1.
Monomer. Homodimer. Interacts with MYD88 and PIAS3 (By similarity). Interacts with EP300.
Belongs to the IRF family.
Research Fields
· Human Diseases > Infectious diseases: Bacterial > Pertussis.
· Human Diseases > Infectious diseases: Viral > Hepatitis C.
· Human Diseases > Infectious diseases: Viral > Human papillomavirus infection.
· Organismal Systems > Endocrine system > Prolactin signaling pathway. (View pathway)
References
Application: WB Species: Human Sample: VSMCS
Application: IF/ICC Species: Human Sample: VSMCS
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.