IMPDH1 Antibody - #DF12642
Product: | IMPDH1 Antibody |
Catalog: | DF12642 |
Description: | Rabbit polyclonal antibody to IMPDH1 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Xenopus |
Mol.Wt.: | 60 kDa, 70 kDa; 55kD(Calculated). |
Uniprot: | P20839 |
RRID: | AB_2845604 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12642, RRID:AB_2845604.
Fold/Unfold
IMDH1_HUMAN; IMP (inosine monophosphate) dehydrogenase 1; IMP dehydrogenase 1; IMPD 1; IMPD; IMPD1; IMPDH 1; IMPDH I; IMPDH-I; Impdh1; Inosine 5' monophosphate dehydrogenase 1; Inosine monophosphate dehydrogenase 1; Inosine-5''-monophosphate dehydrogenase 1; LCA11; RP10; sWSS2608;
Immunogens
IMP type I is the main species in normal leukocytes and type II predominates over type I in the tumor.
- P20839 IMDH1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MADYLISGGTGYVPEDGLTAQQLFASADGLTYNDFLILPGFIDFIADEVDLTSALTRKITLKTPLISSPMDTVTEADMAIAMALMGGIGFIHHNCTPEFQANEVRKVKKFEQGFITDPVVLSPSHTVGDVLEAKMRHGFSGIPITETGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEVMTPRIELVVAPAGVTLKEANEILQRSKKGKLPIVNDCDELVAIIARTDLKKNRDYPLASKDSQKQLLCGAAVGTREDDKYRLDLLTQAGVDVIVLDSSQGNSVYQIAMVHYIKQKYPHLQVIGGNVVTAAQAKNLIDAGVDGLRVGMGCGSICITQEVMACGRPQGTAVYKVAEYARRFGVPIIADGGIQTVGHVVKALALGASTVMMGSLLAATTEAPGEYFFSDGVRLKKYRGMGSLDAMEKSSSSQKRYFSEGDKVKIAQGVSGSIQDKGSIQKFVPYLIAGIQHGCQDIGARSLSVLRSMMYSGELKFEKRTMSAQIEGGVHGLHSYEKRLY
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P20839 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K109 | Ubiquitination | Uniprot | |
S122 | Phosphorylation | Uniprot | |
K134 | Ubiquitination | Uniprot | |
K153 | Ubiquitination | Uniprot | |
S160 | Phosphorylation | Uniprot | |
K169 | Ubiquitination | Uniprot | |
K195 | Ubiquitination | Uniprot | |
R203 | Methylation | Uniprot | |
K205 | Ubiquitination | Uniprot | |
K206 | Ubiquitination | Uniprot | |
K208 | Ubiquitination | Uniprot | |
R231 | Methylation | Uniprot | |
S237 | Phosphorylation | Uniprot | |
K242 | Acetylation | Uniprot | |
K242 | Ubiquitination | Uniprot | |
T252 | Phosphorylation | Uniprot | |
K293 | Ubiquitination | Uniprot | |
T306 | Phosphorylation | Uniprot | |
K311 | Ubiquitination | Uniprot | |
R322 | Methylation | Uniprot | |
Y400 | Phosphorylation | Uniprot | |
K410 | Ubiquitination | Uniprot | |
S416 | Phosphorylation | Uniprot | |
K422 | Ubiquitination | Uniprot | |
K428 | Ubiquitination | Uniprot | |
Y430 | Phosphorylation | Uniprot | |
S432 | Phosphorylation | Uniprot | |
K436 | Acetylation | Uniprot | |
K436 | Ubiquitination | Uniprot | |
K438 | Ubiquitination | Uniprot | |
K450 | Ubiquitination | Uniprot |
Research Backgrounds
Catalyzes the conversion of inosine 5'-phosphate (IMP) to xanthosine 5'-phosphate (XMP), the first committed and rate-limiting step in the de novo synthesis of guanine nucleotides, and therefore plays an important role in the regulation of cell growth. Could also have a single-stranded nucleic acid-binding activity and could play a role in RNA and/or DNA metabolism. It may also have a role in the development of malignancy and the growth progression of some tumors.
Cytoplasm. Nucleus.
IMP type I is the main species in normal leukocytes and type II predominates over type I in the tumor.
Homotetramer.
Belongs to the IMPDH/GMPR family.
Research Fields
· Metabolism > Nucleotide metabolism > Purine metabolism.
· Metabolism > Xenobiotics biodegradation and metabolism > Drug metabolism - other enzymes.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.