GSTO2 Antibody - #DF12627
 (1)  
			
			
			(5)
(1)  
			
			
			(5)  
			
			
		| Product: | GSTO2 Antibody | 
| Catalog: | DF12627 | 
| Description: | Rabbit polyclonal antibody to GSTO2 | 
| Application: | WB IHC IF/ICC | 
| Cited expt.: | WB | 
| Reactivity: | Human, Mouse, Rat | 
| Prediction: | Pig, Zebrafish, Bovine, Sheep, Rabbit | 
| Mol.Wt.: | 28 kDa; 28kD(Calculated). | 
| Uniprot: | Q9H4Y5 | 
| RRID: | AB_2845589 | 
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12627, RRID:AB_2845589.
Fold/Unfold
bA127L20.1; glutathione dependent dehydroascorbate reductase; Glutathione S transferase like protein; glutathione S transferase omega 2 2; Glutathione S transferase omega 2; Glutathione S-transferase omega-2; GSTO 2 2; GSTO 2; GSTO-2; GSTO2; GSTO2_HUMAN; MMA(V) reductase; monomethylarsonic acid reductase; novel glutathione S transferase;
Immunogens
A synthesized peptide derived from human GSTO2, corresponding to a region within N-terminal amino acids.
Expressed in a range of tissues, including the liver, kidney, skeletal muscle and prostate. Strongest expression in the testis.
- Q9H4Y5 GSTO2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSGDATRTLGKGSQPPGPVPEGLIRIYSMRFCPYSHRTRLVLKAKDIRHEVVNINLRNKPEWYYTKHPFGHIPVLETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELFCKVPHLTKECLVALRCGRECTNLKAALRQEFSNLEEILEYQNTTFFGGTCISMIDYLLWPWFERLDVYGILDCVSHTPALRLWISAMKWDPTVCALLMDKSIFQGFLNLYFQNNPNAFDFGLC
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Exhibits glutathione-dependent thiol transferase activity. Has high dehydroascorbate reductase activity and may contribute to the recycling of ascorbic acid. Participates in the biotransformation of inorganic arsenic and reduces monomethylarsonic acid (MMA).
Expressed in a range of tissues, including the liver, kidney, skeletal muscle and prostate. Strongest expression in the testis.
Belongs to the GST superfamily. Omega family.
Research Fields
· Human Diseases > Drug resistance: Antineoplastic > Platinum drug resistance.
· Human Diseases > Cancers: Overview > Pathways in cancer. (View pathway)
· Human Diseases > Cancers: Overview > Chemical carcinogenesis.
· Human Diseases > Cancers: Specific types > Hepatocellular carcinoma. (View pathway)
· Metabolism > Metabolism of other amino acids > Glutathione metabolism.
· Metabolism > Xenobiotics biodegradation and metabolism > Metabolism of xenobiotics by cytochrome P450.
· Metabolism > Xenobiotics biodegradation and metabolism > Drug metabolism - cytochrome P450.
· Metabolism > Xenobiotics biodegradation and metabolism > Drug metabolism - other enzymes.
References
Application: WB Species: Mouse Sample: HT22 cells
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.
 
											 
											 
											 
											