GSTO1 Antibody - #DF12626
| Product: | GSTO1 Antibody |
| Catalog: | DF12626 |
| Description: | Rabbit polyclonal antibody to GSTO1 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Dog, Chicken |
| Mol.Wt.: | 30 kDa; 28kD(Calculated). |
| Uniprot: | P78417 |
| RRID: | AB_2845588 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12626, RRID:AB_2845588.
Fold/Unfold
AA407097; AI194287; AU018802; DKFZp686H13163; EC 2.5.1.18; Glutathione S transferase omega 1; Glutathione S-transferase omega 1-1; Glutathione S-transferase omega; Glutathione S-transferase omega-1; Glutathione transferase omega 1; Glutathione-dependent dehydroascorbate reductase; Glutathione-S-transferase like; Glutathione-S-transferase omega 1; GSTO 1-1; GSTO-1; GSTO1 1; Gsto1; GSTO1_HUMAN; GSTTLp28; GSTX; Gtsttl; MGC94845; MMA(V) reductase; Monomethylarsonic acid reductase; OTTHUMP00000020429; p28; S-(Phenacyl)glutathione reductase; SPG-R;
Immunogens
Ubiquitous. Highest expression in liver, pancreas, skeletal muscle, spleen, thymus, colon, blood leukocyte and heart. Lowest expression in brain, placenta and lung.
- P78417 GSTO1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P78417 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S2 | Acetylation | Uniprot | |
| S8 | Phosphorylation | Uniprot | |
| K11 | Ubiquitination | Uniprot | |
| S13 | O-Glycosylation | Uniprot | |
| S13 | Phosphorylation | Uniprot | |
| S23 | Phosphorylation | Uniprot | |
| R30 | Methylation | Uniprot | |
| K57 | Acetylation | Uniprot | |
| K57 | Sumoylation | Uniprot | |
| K59 | Acetylation | Uniprot | |
| K59 | Ubiquitination | Uniprot | |
| K65 | Acetylation | Uniprot | |
| K65 | Ubiquitination | Uniprot | |
| S78 | Phosphorylation | Uniprot | |
| K100 | Acetylation | Uniprot | |
| K101 | Ubiquitination | Uniprot | |
| K110 | Ubiquitination | Uniprot | |
| S121 | Phosphorylation | Uniprot | |
| K122 | Acetylation | Uniprot | |
| S125 | Phosphorylation | Uniprot | |
| S129 | Phosphorylation | Uniprot | |
| K136 | Ubiquitination | Uniprot | |
| Y139 | Phosphorylation | Uniprot | |
| K143 | Acetylation | Uniprot | |
| K143 | Ubiquitination | Uniprot | |
| K148 | Acetylation | Uniprot | |
| K152 | Acetylation | Uniprot | |
| K152 | Ubiquitination | Uniprot | |
| K160 | Acetylation | Uniprot | |
| K160 | Ubiquitination | Uniprot | |
| K161 | Acetylation | Uniprot | |
| K188 | Ubiquitination | Uniprot | |
| K198 | Ubiquitination | Uniprot | |
| K207 | Ubiquitination | Uniprot | |
| T217 | Phosphorylation | Uniprot | |
| S218 | Phosphorylation | Uniprot | |
| Y229 | Phosphorylation | Uniprot | |
| S233 | Phosphorylation | Uniprot | |
| Y239 | Phosphorylation | Uniprot |
Research Backgrounds
Exhibits glutathione-dependent thiol transferase and dehydroascorbate reductase activities. Has S-(phenacyl)glutathione reductase activity. Has also glutathione S-transferase activity. Participates in the biotransformation of inorganic arsenic and reduces monomethylarsonic acid (MMA) and dimethylarsonic acid.
Cytoplasm>Cytosol.
Ubiquitous. Highest expression in liver, pancreas, skeletal muscle, spleen, thymus, colon, blood leukocyte and heart. Lowest expression in brain, placenta and lung.
Homodimer.
Belongs to the GST superfamily. Omega family.
Research Fields
· Human Diseases > Drug resistance: Antineoplastic > Platinum drug resistance.
· Human Diseases > Cancers: Overview > Pathways in cancer. (View pathway)
· Human Diseases > Cancers: Overview > Chemical carcinogenesis.
· Human Diseases > Cancers: Specific types > Hepatocellular carcinoma. (View pathway)
· Metabolism > Metabolism of other amino acids > Glutathione metabolism.
· Metabolism > Xenobiotics biodegradation and metabolism > Metabolism of xenobiotics by cytochrome P450.
· Metabolism > Xenobiotics biodegradation and metabolism > Drug metabolism - cytochrome P450.
· Metabolism > Xenobiotics biodegradation and metabolism > Drug metabolism - other enzymes.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.