Product: GSTA3 Antibody
Catalog: DF12624
Description: Rabbit polyclonal antibody to GSTA3
Application: WB
Reactivity: Human, Mouse, Rat
Mol.Wt.: 25 kDa; 25kD(Calculated).
Uniprot: Q16772
RRID: AB_2845586

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
GSTA3 Antibody detects endogenous levels of total GSTA3.
RRID:
AB_2845586
Cite Format: Affinity Biosciences Cat# DF12624, RRID:AB_2845586.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Glutathione S alkyltransferase A3; Glutathione S aralkyltransferase A3; Glutathione S aryltransferase A3; Glutathione S transferase A3 3; Glutathione S transferase A3; glutathione S transferase A3 subunit; Glutathione S transferase alpha 3; Glutathione S transferase alpha type (Ya); glutathione S transferase Yc 1; glutathione S transferase Yc1 subunit; Glutathione S-transferase A3; Glutathione S-transferase A3-3; Glutathione S-transferase Ya3; Glutathione S-transferase Yc; glutathione transferase A3 subunit; Glutathione transferase alpha 3; GST 2 2; GST AA; GST class alpha; GST class alpha member 3; GST class-alpha member 3; GST Yc1; GSTA 3; GSTA3 3; Gsta3; GSTA3-3; GSTA3_HUMAN; Gstyc; GTA 3; GTA3; MGC22232; S (hydroxyalkyl)glutathione lyase A3; Yc1;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Sequence:
MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAEDLGKLRNDGSLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAKIALIKEKTKSRYFPAFEKVLQSHGQDYLVGNKLSRADISLVELLYYVEELDSSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFRF

PTMs - Q16772 As Substrate

Site PTM Type Enzyme
S49 Phosphorylation
Y74 Phosphorylation
S77 Phosphorylation
Y79 Phosphorylation
Y82 Phosphorylation
K84 Acetylation
K87 Acetylation
K125 Ubiquitination
S142 Phosphorylation
Y147 Phosphorylation
K152 Acetylation
S154 Phosphorylation
S189 Phosphorylation
T193 Phosphorylation
K195 Acetylation
K196 Acetylation
S202 Phosphorylation

Research Backgrounds

Function:

Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Catalyzes isomerization reactions that contribute to the biosynthesis of steroid hormones. Efficiently catalyze obligatory double-bond isomerizations of delta(5)-androstene-3,17-dione and delta(5)-pregnene-3,20-dione, precursors to testosterone and progesterone, respectively.

Subcellular Location:

Cytoplasm.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Homodimer.

Family&Domains:

Belongs to the GST superfamily. Alpha family.

Research Fields

· Human Diseases > Drug resistance: Antineoplastic > Platinum drug resistance.

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cancers: Overview > Chemical carcinogenesis.

· Human Diseases > Cancers: Specific types > Hepatocellular carcinoma.   (View pathway)

· Metabolism > Metabolism of other amino acids > Glutathione metabolism.

· Metabolism > Xenobiotics biodegradation and metabolism > Metabolism of xenobiotics by cytochrome P450.

· Metabolism > Xenobiotics biodegradation and metabolism > Drug metabolism - cytochrome P450.

· Metabolism > Xenobiotics biodegradation and metabolism > Drug metabolism - other enzymes.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.