GSTA3 Antibody | Affinity Biosciences

WB
Cites

1/2

Western blot analysis of extracts from MCF-7 cells, using GSTA3 Antibody.

Product:	GSTA3 Antibody
Catalog:	DF12624
Description:	Rabbit polyclonal antibody to GSTA3
Application:	WB
Reactivity:	Human, Mouse, Rat
Mol.Wt.:	25 kDa; 25kD(Calculated).
Uniprot:	Q16772
RRID:	AB_2845586

View similar products>>

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific.

Size	Price	Inventory
100ul	$280	In stock
200ul	$350	In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Related Downloads

MS Report

HPLC Report

MSDS

Data Sheet

COA

Protocols

WB Handbook

IHC Protocol

IF/ICC Protocol

Product Info

Source:

Rabbit

Application:

WB 1:500-1:2000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:

Human,Mouse,Rat

Clonality:

Polyclonal

Specificity:

GSTA3 Antibody detects endogenous levels of total GSTA3.

RRID:

AB_2845586
Cite Format: Affinity Biosciences Cat# DF12624, RRID:AB_2845586.

Conjugate:

Unconjugated.

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Storage:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.

Alias:

Fold/Unfold

Glutathione S alkyltransferase A3; Glutathione S aralkyltransferase A3; Glutathione S aryltransferase A3; Glutathione S transferase A3 3; Glutathione S transferase A3; glutathione S transferase A3 subunit; Glutathione S transferase alpha 3; Glutathione S transferase alpha type (Ya); glutathione S transferase Yc 1; glutathione S transferase Yc1 subunit; Glutathione S-transferase A3; Glutathione S-transferase A3-3; Glutathione S-transferase Ya3; Glutathione S-transferase Yc; glutathione transferase A3 subunit; Glutathione transferase alpha 3; GST 2 2; GST AA; GST class alpha; GST class alpha member 3; GST class-alpha member 3; GST Yc1; GSTA 3; GSTA3 3; Gsta3; GSTA3-3; GSTA3_HUMAN; Gstyc; GTA 3; GTA3; MGC22232; S (hydroxyalkyl)glutathione lyase A3; Yc1;

Immunogens

Immunogen:

Uniprot:

Q16772(GSTA3_HUMAN) >>Visit HPA database.

Gene(ID):

GSTA3(2940)

Sequence:

Q16772 GSTA3_HUMAN:
Protein BLAST With
NCBI/
ExPASy/
Uniprot

MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAEDLGKLRNDGSLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAKIALIKEKTKSRYFPAFEKVLQSHGQDYLVGNKLSRADISLVELLYYVEELDSSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFRF

PTMs - Q16772 As Substrate

Q16772

Site	PTM Type	Source
S49	Phosphorylation	Uniprot
Y74	Phosphorylation	Uniprot
S77	Phosphorylation	Uniprot
Y79	Phosphorylation	Uniprot
Y82	Phosphorylation	Uniprot
K84	Acetylation	Uniprot
K87	Acetylation	Uniprot
K125	Ubiquitination	Uniprot
S142	Phosphorylation	Uniprot
Y147	Phosphorylation	Uniprot
K152	Acetylation	Uniprot
S154	Phosphorylation	Uniprot
S189	Phosphorylation	Uniprot
T193	Phosphorylation	Uniprot
K195	Acetylation	Uniprot
K196	Acetylation	Uniprot
S202	Phosphorylation	Uniprot

Research Backgrounds

Q16772_GSTA3_HUMAN

Function:

Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Catalyzes isomerization reactions that contribute to the biosynthesis of steroid hormones. Efficiently catalyze obligatory double-bond isomerizations of delta(5)-androstene-3,17-dione and delta(5)-pregnene-3,20-dione, precursors to testosterone and progesterone, respectively.

Subcellular Location:

Cytoplasm.

Subunit Structure:

Homodimer.

Family&Domains:

Belongs to the GST superfamily. Alpha family.

Research Fields

· Human Diseases > Drug resistance: Antineoplastic > Platinum drug resistance.

· Human Diseases > Cancers: Overview > Pathways in cancer. (View pathway)

· Human Diseases > Cancers: Overview > Chemical carcinogenesis.

· Human Diseases > Cancers: Specific types > Hepatocellular carcinoma. (View pathway)

· Metabolism > Metabolism of other amino acids > Glutathione metabolism.

· Metabolism > Xenobiotics biodegradation and metabolism > Metabolism of xenobiotics by cytochrome P450.

· Metabolism > Xenobiotics biodegradation and metabolism > Drug metabolism - cytochrome P450.

· Metabolism > Xenobiotics biodegradation and metabolism > Drug metabolism - other enzymes.

References

1). Long-Term Sleep Deprivation-Induced Myocardial Remodeling and Mitochondrial Dysfunction in Mice Were Attenuated by Lipoic Acid and N-Acetylcysteine. Pharmaceuticals (Basel, Switzerland), 2022 (PubMed: 36678548) [IF=4.6]

Application: WB Species: Mouse Sample: hearts

Figure 3. RNA sequencing revealed the Sirt1−Gsta3 axis is involved in CSD−regulated heart dysfunction. (A) RNA sequencing heat map clustered in hierarchy volcano map (B) shows up− or down−regulated genes in NC and CSD hearts. (C) Signal pathway analysis of the differential expression (DE) gene of RNA−seq shows the top 10 pathways related to CSD treatment. (D) Heat map clustered in hierarchy shows that Sirt1 of the Nicotinate and nicotinamide metabolism pathway (Left panel) and Gsta3 of the metabolic pathway were downregulated in the CSD heart. (E) Representative Western blot images and quantification of Sirt1 and Gsta3 in NC and CSD hearts. (F) Representative Western blot images and quantification of phosphorylation or total of AMPK and Akt in NC and CSD hearts.

Restrictive clause

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.

GSTA3 Antibody - #DF12624