GALE Antibody - #DF12611
Product: | GALE Antibody |
Catalog: | DF12611 |
Description: | Rabbit polyclonal antibody to GALE |
Application: | WB |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog |
Mol.Wt.: | 38 kDa; 38kD(Calculated). |
Uniprot: | Q14376 |
RRID: | AB_2845573 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12611, RRID:AB_2845573.
Fold/Unfold
FLJ95174; FLJ97302; Galactose 4 epimerase UDP; Galactowaldenase; galE; GALE_HUMAN; OTTHUMP00000002991; OTTHUMP00000002994; OTTHUMP00000037931; OTTHUMP00000044857; SDR1E1; short chain dehydrogenase/reductase family 1E member 1; UDP galactose 4 epimerase; UDP galactose 4' epimerase; UDP glucose 4 epimerase; UDP-galactose 4-epimerase; UDP-glucose 4-epimerase;
Immunogens
- Q14376 GALE_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q14376 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S44 | Phosphorylation | Uniprot | |
Y80 | Phosphorylation | Uniprot | |
S81 | Phosphorylation | Uniprot | |
S97 | Phosphorylation | Uniprot | |
K100 | Ubiquitination | Uniprot | |
Y104 | Phosphorylation | Uniprot | |
K120 | Ubiquitination | Uniprot | |
Y157 | Phosphorylation | Uniprot | |
K159 | Ubiquitination | Uniprot | |
K161 | Ubiquitination | Uniprot | |
K176 | Ubiquitination | Uniprot | |
T232 | Phosphorylation | Uniprot | |
K249 | Ubiquitination | Uniprot | |
K259 | Ubiquitination | Uniprot | |
K286 | Ubiquitination | Uniprot | |
K295 | Ubiquitination | Uniprot | |
K338 | Ubiquitination | Uniprot |
Research Backgrounds
Catalyzes two distinct but analogous reactions: the reversible epimerization of UDP-glucose to UDP-galactose and the reversible epimerization of UDP-N-acetylglucosamine to UDP-N-acetylgalactosamine. The reaction with UDP-Gal plays a critical role in the Leloir pathway of galactose catabolism in which galactose is converted to the glycolytic intermediate glucose 6-phosphate. It contributes to the catabolism of dietary galactose and enables the endogenous biosynthesis of both UDP-Gal and UDP-GalNAc when exogenous sources are limited. Both UDP-sugar interconversions are important in the synthesis of glycoproteins and glycolipids.
Homodimer.
Belongs to the NAD(P)-dependent epimerase/dehydratase family.
Research Fields
· Metabolism > Carbohydrate metabolism > Galactose metabolism.
· Metabolism > Carbohydrate metabolism > Amino sugar and nucleotide sugar metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.