Cytohesin2 Antibody - #DF12592
Product: | Cytohesin2 Antibody |
Catalog: | DF12592 |
Description: | Rabbit polyclonal antibody to Cytohesin2 |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Dog |
Mol.Wt.: | 47 kDa; 47kD(Calculated). |
Uniprot: | Q99418 |
RRID: | AB_2845554 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12592, RRID:AB_2845554.
Fold/Unfold
ARF exchange factor; ARF nucleotide binding site opener; ARF nucleotide-binding site opener; Arno; ARNO protein; CLM2; CTS18; CTS18.1; CYH2_HUMAN; Cyth2; Cytohesin 2; Cytohesin-2; MGC137537; MGC80440; PH; PH, SEC7 and coiled-coil domain-containing protein 2; Pleckstrin homology Sec7 and coiled coil domains 2; Pleckstrin homology Sec7 and coiled coil domains protein 2; Protein ARNO; PSCD2; PSCD2L; PSCD2L, formerly; SEC7 and coiled-coil domain-containing protein 2; Sec7; SEC7 homolog B; Sec7B; SEC7L; Sec7p L; Sec7p-like; Sec7pL;
Immunogens
- Q99418 CYH2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEDGVYEPPDLTPEERMELENIRRRKQELLVEIQRLREELSEAMSEVEGLEANEGSKTLQRNRKMAMGRKKFNMDPKKGIQFLVENELLQNTPEEIARFLYKGEGLNKTAIGDYLGEREELNLAVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQSTDTCYVLSFAVIMLNTSLHNPNVRDKPGLERFVAMNRGINEGGDLPEELLRNLYDSIRNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPTQEEKDEWIKSIQAAVSVDPFYEMLAARKKRISVKKKQEQP
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q99418 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K26 | Ubiquitination | Uniprot | |
S45 | Phosphorylation | Uniprot | |
S56 | Phosphorylation | Uniprot | |
K57 | Ubiquitination | Uniprot | |
T58 | Phosphorylation | Uniprot | |
K78 | Ubiquitination | Uniprot | |
K102 | Ubiquitination | Uniprot | |
K159 | Ubiquitination | Uniprot | |
Y235 | Phosphorylation | Uniprot | |
K244 | Ubiquitination | Uniprot | |
K268 | Ubiquitination | Uniprot | |
T276 | Phosphorylation | P31749 (AKT1) | Uniprot |
K319 | Ubiquitination | Uniprot | |
T360 | Phosphorylation | Uniprot | |
K364 | Ubiquitination | Uniprot | |
Y381 | Phosphorylation | Uniprot | |
S392 | Phosphorylation | P05771 (PRKCB) , P05129 (PRKCG) , P17252 (PRKCA) | Uniprot |
Research Backgrounds
Acts as a guanine-nucleotide exchange factor (GEF). Promotes guanine-nucleotide exchange on ARF1, ARF3 and ARF6. Activates ARF factors through replacement of GDP with GTP (By similarity). The cell membrane form, in association with ARL4 proteins, recruits ARF6 to the plasma membrane. Involved in neurite growth (By similarity).
Cell membrane>Peripheral membrane protein. Cytoplasm. Cell projection. Cell projection>Growth cone. Cell junction>Tight junction. Cell junction>Adherens junction.
Note: Both isoform 1 and isoform 2 are recruited to the cell membrane through its association with ARL4A, ARL4C and ARL4D. They require also interaction with phosphoinositides for targeting to plasma membrane (PubMed:17398095). In differentiating neuroblastoma cells, colocalizes with CCDC120 in both neurite shaft and growth cone areas.
Widely expressed.
Heteromer. Composed of GRASP, CYTH2 and at least one GRM1 (By similarity). Interacts with ARRB1. Interacts with ARL4D; the interaction is direct. Directly interacts with CCDC120 through the coiled coil domain; this interaction stabilizes CCDC120, possibly by preventing its ubiquitination, and is required for neurite growth in neuroblastoma cells. Interacts with ARF1. Interacts with FRMD4A (By similarity). Interacts (via N-terminal domain) with INAVA (via N-terminal domain).
Binds via its PH domain to the inositol head group of phosphatidylinositol 1,4,5-trisphosphate. The PH domain is necessary and sufficient for plasma membrane relocalization.
Autoinhibited by its C-terminal basic region.
The coiled coil domain is involved in interaction with CCDC120.
Research Fields
· Cellular Processes > Transport and catabolism > Endocytosis. (View pathway)
· Environmental Information Processing > Signal transduction > Phospholipase D signaling pathway. (View pathway)
References
Application: WB Species: human Sample: MHCC97H cells
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.