CPLX3 Antibody - #DF12587
| Product: | CPLX3 Antibody |
| Catalog: | DF12587 |
| Description: | Rabbit polyclonal antibody to CPLX3 |
| Application: | WB |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Dog |
| Mol.Wt.: | 22 kDa; 18kD(Calculated). |
| Uniprot: | Q8WVH0 |
| RRID: | AB_2845549 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12587, RRID:AB_2845549.
Fold/Unfold
Complexin 3; Complexin III; Complexin-3; CPLX3; CPLX3_HUMAN; CPX III; CPX-III; CPXIII; ERGIC 53L; ERGL; FLJ13993; Lamn1l; Nbla11589;
Immunogens
- Q8WVH0 CPLX3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAFMVKTMVGGQLKNLTGSLGGGEDKGDGDKSAAEAQGMSREEYEEYQKQLVEEKMERDAQFTQRKAERATLRSHFRDKYRLPKNETDESQIQMAGGDVELPRELAKMIEEDTEEEEEKASVLGQLASLPGLNLGSLKDKAQATLGDLKQSAEKCHVM
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Complexin that regulates SNARE protein complex-mediated synaptic vesicle fusion (By similarity). Required for the maintenance of synaptic ultrastructure in the adult retina (By similarity). Positively regulates synaptic transmission through synaptic vesicle availability and exocytosis of neurotransmitters at photoreceptor ribbon synapses in the retina (By similarity). Suppresses tonic photoreceptor activity and baseline 'noise' by suppression of Ca(2+) vesicle tonic release and the facilitation of evoked synchronous and asynchronous Ca(2+) vesicle release (By similarity).
Farnesylation mediates presynaptic targeting.
Cell junction>Synapse. Cell membrane>Lipid-anchor.
Note: Enriched at the synaptic terminal (By similarity). Localized at glycinergic synaptic contacts of AII amacrine cells with OFF cone bipolar cells in the OFF sublamina of the retina inner nuclear layer (By similarity).
Binds to the SNARE core complex containing SNAP25, VAMP2 and STX1A.
Belongs to the complexin/synaphin family.
Research Fields
· Organismal Systems > Nervous system > Synaptic vesicle cycle.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.