BNIP1 Antibody - #DF12569
Product: | BNIP1 Antibody |
Catalog: | DF12569 |
Description: | Rabbit polyclonal antibody to BNIP1 |
Application: | WB |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 26 kDa; 26kD(Calculated). |
Uniprot: | Q12981 |
RRID: | AB_2845531 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12569, RRID:AB_2845531.
Fold/Unfold
BCL2 adenovirus E1B 19kD interacting protein 1; BCL2/adenovirus E1B 19 kDa protein-interacting protein 1; BNIP1; MGC41600; Nip1; OTTHUMP00000161077; OTTHUMP00000161078; OTTHUMP00000161079; OTTHUMP00000223580; sec20; SEC20_HUMAN; SEC20L; Transformation-related gene 8 protein; TRG-8; TRG8; Vesicle transport protein SEC20;
Immunogens
Isoform 1 is highly expressed in heart, brain, liver skeletal muscle and pancreas. Isoform 3 is moderately expressed in placenta, lung and kidney. Isoform 4 is highly expressed in testis and small intestine.
- Q12981 SEC20_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAAPQDVHVRICNQEIVKFDLEVKALIQDIRDCSGPLSALTELNTKVKEKFQQLRHRIQDLEQLAKEQDKESEKQLLLQEVENHKKQMLSNQASWRKANLTCKIAIDNLEKAELLQGGDLLRQRKTTKESLAQTSSTITESLMGISRMMAQQVQQSEEAMQSLVTSSRTILDANEEFKSMSGTIQLGRKLITKYNRRELTDKLLIFLALALFLATVLYIVKKRLFPFL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q12981 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K46 | Acetylation | Uniprot | |
K46 | Ubiquitination | Uniprot | |
K48 | Acetylation | Uniprot | |
K48 | Methylation | Uniprot | |
K50 | Methylation | Uniprot | |
K50 | Ubiquitination | Uniprot | |
K66 | Ubiquitination | Uniprot | |
K74 | Ubiquitination | Uniprot | |
K86 | Ubiquitination | Uniprot | |
S90 | Phosphorylation | Uniprot | |
S94 | Phosphorylation | Uniprot | |
K103 | Ubiquitination | Uniprot | |
K111 | Ubiquitination | Uniprot | |
T126 | Phosphorylation | Uniprot | |
T127 | Phosphorylation | Uniprot | |
K128 | Ubiquitination | Uniprot | |
K178 | Ubiquitination | Uniprot | |
S181 | Phosphorylation | Uniprot | |
K189 | Acetylation | Uniprot | |
K193 | Acetylation | Uniprot | |
T200 | Phosphorylation | Uniprot | |
T215 | Phosphorylation | Uniprot | |
Y218 | Phosphorylation | Uniprot |
Research Backgrounds
As part of a SNARE complex may be involved in endoplasmic reticulum membranes fusion and be required for the maintenance of endoplasmic reticulum organization. Plays also a role in apoptosis. It is for instance required for endoplasmic reticulum stress-induced apoptosis. As a substrate of RNF185 interacting with SQSTM1, might also be involved in mitochondrial autophagy (Probable).
Polyubiquitinated. 'Lys-63'-linked polyubiquitination by RNF185 increases the interaction with the autophagy receptor SQSTM1. Undergoes 'Lys-29'- and 'Lys-63'-linked polyubiquitination by RNF186 that may regulate BNIP1 localization to the mitochondrion.
Endoplasmic reticulum membrane>Single-pass type IV membrane protein. Mitochondrion membrane>Single-pass type IV membrane protein.
Note: Localization to the mitochondrion is regulated by RNF186.
Isoform 1 is highly expressed in heart, brain, liver skeletal muscle and pancreas. Isoform 3 is moderately expressed in placenta, lung and kidney. Isoform 4 is highly expressed in testis and small intestine.
Component of a SNARE complex consisting of STX18, USE1L, BNIP1/SEC20L and SEC22B. Interacts directly with STX18, RINT1/TIP20L and NAPA. Interacts with ZW10 through RINT1. Interacts with BCL2. Interacts with RNF186. Interacts with RNF185. Interacts with SQSTM1; increased by 'Lys-63'-linked polyubiquitination of BNIP1.
(Microbial infection) Interacts with adenovirus E1B 19K protein; plays a role in the suppression of cell apoptosis by the viral protein.
Belongs to the SEC20 family.
Research Fields
· Genetic Information Processing > Folding, sorting and degradation > SNARE interactions in vesicular transport.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.