ADI1 Antibody - #DF12555
| Product: | ADI1 Antibody |
| Catalog: | DF12555 |
| Description: | Rabbit polyclonal antibody to ADI1 |
| Application: | WB |
| Reactivity: | Human, Mouse, Rat |
| Mol.Wt.: | 20 kDa; 21kD(Calculated). |
| Uniprot: | Q9BV57 |
| RRID: | AB_2845517 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12555, RRID:AB_2845517.
Fold/Unfold
1 2 dihydroxy 3 keto 5 methylthiopentene dioxygenase; 1; 2-dihydroxy-3-keto-5-methylthiopentene dioxygenase; Aci reductone dioxygenase; Acireductone dioxygenase (Fe(2+) requiring); Acireductone dioxygenase (Ni(2+) requiring); Acireductone dioxygenase (Ni(2+)-requiring); Acireductone dioxygenase 1; ADI 1; Adi1; ADI1 antibody; APL1; ARD; EC 1.13.; Fe ARD; FLJ10913; HMFT1638; Membrane type 1 matrix metalloproteinase cytoplasmic tail binding protein 1; Membrane-type 1 matrix metalloproteinase cytoplasmic tail-binding protein 1; MT1 MMP cytoplasmic tail binding protein 1; MTCBP 1; MTCBP-1; MTCBP1; MTND_HUMAN; Ni-ARD; SIPL; Submergence induced protein 2; Submergence induced protein 2 homolog; Submergence induced protein like factor; Submergence-induced protein 2 homolog;
Immunogens
Detected in heart, colon, lung, stomach, brain, spleen, liver, skeletal muscle and kidney.
- Q9BV57 MTND_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVQAWYMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWKLDADKYENDPELEKIRRERNYSWMDIITICKDKLPNYEEKIKMFYEEHLHLDDEIRYILDGSGYFDVRDKEDQWIRIFMEKGDMVTLPAGIYHRFTVDEKNYTKAMRLFVGEPVWTAYNRPADHFEARGQYVKFLAQTA
PTMs - Q9BV57 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| R32 | Methylation | Uniprot | |
| K40 | Ubiquitination | Uniprot | |
| K45 | Ubiquitination | Uniprot | |
| Y46 | Phosphorylation | Uniprot | |
| K54 | Ubiquitination | Uniprot | |
| K73 | Acetylation | Uniprot | |
| K73 | Ubiquitination | Uniprot | |
| K80 | Ubiquitination | Uniprot | |
| S102 | Phosphorylation | Uniprot | |
| Y104 | Phosphorylation | Uniprot | |
| K110 | Ubiquitination | Uniprot | |
| K121 | Ubiquitination | Uniprot | |
| K140 | Ubiquitination | Uniprot | |
| K144 | Ubiquitination | Uniprot | |
| K173 | Ubiquitination | Uniprot |
Research Backgrounds
Catalyzes the formation of formate and 2-keto-4-methylthiobutyrate (KMTB) from 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene). Also down-regulates cell migration mediated by MMP14. Necessary for hepatitis C virus replication in an otherwise non-permissive cell line.
Cytoplasm. Nucleus. Cell membrane>Peripheral membrane protein>Cytoplasmic side.
Note: Localizes to the plasma membrane when complexed to MMP14.
Detected in heart, colon, lung, stomach, brain, spleen, liver, skeletal muscle and kidney.
Monomer (By similarity). Interacts with MMP14.
Belongs to the acireductone dioxygenase (ARD) family.
Research Fields
· Metabolism > Amino acid metabolism > Cysteine and methionine metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.