ID3 Antibody - #DF12520
(1)
(3)
| Product: | ID3 Antibody |
| Catalog: | DF12520 |
| Description: | Rabbit polyclonal antibody to ID3 |
| Application: | WB |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
| Mol.Wt.: | 42 kDa; 13kD(Calculated). |
| Uniprot: | Q02535 |
| RRID: | AB_2845482 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12520, RRID:AB_2845482.
Fold/Unfold
1R21; bHLHb25; Class B basic helix-loop-helix protein 25; DNA binding protein inhibitor ID 3; DNA-binding protein inhibitor ID-3; HEIR 1; HEIR1; Helix loop helix protein HEIR 1; Helix loop helix protein HEIR1; Helix-loop-helix protein HEIR-1; HLH642; ID 3; ID like protein inhibitor HLH 1R21; ID like protein inhibitor HLH 462; ID-like protein inhibitor HLH 1R21; ID3; ID3_HUMAN; Inhibitor of DNA binding 3; Inhibitor of DNA binding 3 dominant negative helix loop helix protein;
Immunogens
- Q02535 ID3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELTPELVISNDKRSFCH
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q02535 As Substrate
Research Backgrounds
Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated in regulating a variety of cellular processes, including cellular growth, senescence, differentiation, apoptosis, angiogenesis, and neoplastic transformation. Involved in myogenesis by inhibiting skeletal muscle and cardiac myocyte differentiation and promoting muscle precursor cells proliferation. Inhibits the binding of E2A-containing protein complexes to muscle creatine kinase E-box enhancer. Regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-ARNTL/BMAL1 heterodimer.
Nucleus.
Expressed abundantly in lung, kidney and adrenal gland, but not in adult brain.
Homodimer, and heterodimer with other HLH proteins. Interacts with COPS5 and COPS7A. Interacts with IFI204. Interacts with GATA4 and NKX2-5. Interacts with ANKRD2; both proteins cooperate in myoblast differentiation (By similarity). Interacts with CLOCK and ARNTL/BMAL1.
Research Fields
· Cellular Processes > Cellular community - eukaryotes > Signaling pathways regulating pluripotency of stem cells. (View pathway)
· Environmental Information Processing > Signal transduction > TGF-beta signaling pathway. (View pathway)
References
Application: WB Species: sheep Sample:
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.