Cleaved-Caspase 1 (Ala317), p10 Antibody

Product:	Cleaved-Caspase 1 (Ala317), p10 Antibody
Catalog:	AF4022
Description:	Rabbit polyclonal antibody to Cleaved-Caspase 1 (Ala317), p10
Application:	WB IHC IF/ICC
Reactivity:	Human, Mouse, Rat
Prediction:	Pig, Bovine, Horse, Rabbit, Dog
Mol.Wt.:	10kD,45kD; 45kD(Calculated).
Uniprot:	P29466
RRID:	AB_2845464

View similar products>>

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific.

Size	Price	Inventory
50ul	$250	In stock
100ul	$350	In stock
200ul	$450	In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Related Downloads

MSDS

Data Sheet

COA

Protocols

WB Handbook

IHC Protocol

IF/ICC Protocol

Product Info

Source:

Rabbit

Application:

WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:

Human,Mouse,Rat

Prediction:

Pig(100%), Bovine(100%), Horse(88%), Rabbit(100%), Dog(88%)

Clonality:

Polyclonal

Specificity:

Cleaved-Caspase-1 (Ala317,p10) Antibody detects endogenous levels of fragment of activated Caspase-1 resulting from cleavage adjacent to Ala317.

RRID:

AB_2845464
Cite Format: Affinity Biosciences Cat# AF4022, RRID:AB_2845464.

Conjugate:

Unconjugated.

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Storage:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.

Alias:

Fold/Unfold

CASP-1; CASP1; CASP1_HUMAN; Caspase 1; Caspase-1 subunit p10; ICE; IL-1 beta-converting enzyme; IL-1BC; IL1 beta converting enzyme; IL1B convertase; Interleukin 1 beta convertase; Interleukin 1B converting enzyme; Interleukin-1 beta convertase; Interleukin-1 beta-converting enzyme; p45;

Immunogens

Immunogen:

Uniprot:

P29466(CASP1_HUMAN) >>Visit HPA database.

Gene(ID):

CASP1(834)

Expression:

P29466 CASP1_HUMAN:

Expressed in larger amounts in spleen and lung. Detected in liver, heart, small intestine, colon, thymus, prostate, skeletal muscle, peripheral blood leukocytes, kidney and testis. No expression in the brain.

Sequence:

P29466 CASP1_HUMAN:
Protein BLAST With
NCBI/
ExPASy/
Uniprot

MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEEDSYLAGTLGLSADQTSGNYLNMQDSQGVLSSFPAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species

Results

Score

Pig

100

Bovine

100

Rabbit

100

Horse

Dog

Sheep

Xenopus

Zebrafish

Chicken

Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P29466 As Substrate

P29466

Site	PTM Type	Source
S16	Phosphorylation	Uniprot
T21	Phosphorylation	Uniprot
T32	Phosphorylation	Uniprot
K37	Ubiquitination	Uniprot
K44	Ubiquitination	Uniprot
T49	Phosphorylation	Uniprot
K53	Ubiquitination	Uniprot
K134	Ubiquitination	Uniprot
K148	Ubiquitination	Uniprot
S149	Phosphorylation	Uniprot
K158	Ubiquitination	Uniprot
K204	Ubiquitination	Uniprot
T226	Phosphorylation	Uniprot
S227	Phosphorylation	Uniprot
K268	Ubiquitination	Uniprot
K274	Ubiquitination	Uniprot
K278	Ubiquitination	Uniprot
S306	Phosphorylation	Uniprot
K319	Ubiquitination	Uniprot
K320	Ubiquitination	Uniprot
K325	Ubiquitination	Uniprot
S376	Phosphorylation	Uniprot

Research Backgrounds

P29466_CASP1_HUMAN

Function:

Thiol protease that cleaves IL-1 beta between an Asp and an Ala, releasing the mature cytokine which is involved in a variety of inflammatory processes. Important for defense against pathogens. Cleaves and activates sterol regulatory element binding proteins (SREBPs). Can also promote apoptosis. Upon inflammasome activation, during DNA virus infection but not RNA virus challenge, controls antiviral immunity through the cleavage of CGAS, rendering it inactive. In apoptotic cells, cleaves SPHK2 which is released from cells and remains enzymatically active extracellularly.

PTMs:

The two subunits are derived from the precursor sequence by an autocatalytic mechanism.

Subcellular Location:

Cytoplasm. Cell membrane.

Tissue Specificity:

Subunit Structure:

Heterotetramer that consists of two anti-parallel arranged heterodimers, each one formed by a 20 kDa (p20) and a 10 kDa (p10) subunit. The p20 subunit can also form a heterodimer with the epsilon isoform which then has an inhibitory effect. May be a component of the inflammasome, a protein complex which also includes PYCARD, CARD8 and NALP2 and whose function would be the activation of proinflammatory caspases. Both the p10 and p20 subunits interact with MEFV. Interacts with CARD17/INCA and CARD18. Interacts with SERPINB1; this interaction regulates CASP1 activity.

Family&Domains:

Belongs to the peptidase C14A family.

Research Fields

· Cellular Processes > Cell growth and death > Necroptosis. (View pathway)

· Human Diseases > Neurodegenerative diseases > Amyotrophic lateral sclerosis (ALS).

· Human Diseases > Infectious diseases: Bacterial > Salmonella infection.

· Human Diseases > Infectious diseases: Bacterial > Pertussis.

· Human Diseases > Infectious diseases: Bacterial > Legionellosis.

· Human Diseases > Infectious diseases: Viral > Influenza A.

· Organismal Systems > Immune system > NOD-like receptor signaling pathway. (View pathway)

· Organismal Systems > Immune system > Cytosolic DNA-sensing pathway. (View pathway)

References

1). p66Shc Contributes to Liver Fibrosis through the Regulation of Mitochondrial Reactive Oxygen Species. Theranostics, 2019 (PubMed: 30867846) [IF=12.4]

Application: WB Species: mouse Sample: Liver

Figure 2.| p66Shc silencing attenuates liver fibrosis in mice. p66Shc silencing was induced via lentivirus delivered to C57BL/6 mice exposed to CCl4 (2 ml/kg). (A) Liver p66Shc mRNA expression, n=6. (B) Liver p66Shc, SOD2, UCP1, Col1a1, α-SMA protein, n=3. (C) H2O2 content, n=8. (D) SOD activity, n=8. (E) Cytochrome c expression in the cytoplasm and mitochondria, n=3. (F) H&E and Masson staining. Scale bar, 200 μm. (G) Ishak score of Masson staining. (H) Serum ALT and AST levels, n=8. (I) Liver NLRP3 inflammasome protein expression, n=3.

2). Water-extracted Lonicera japonica polysaccharide attenuates allergic rhinitis by regulating NLRP3-IL-17 signaling axis. Carbohydrate Polymers, 2022 (PubMed: 36184153) [IF=11.2]

3). AIM2 Inflammasome Mediates Hallmark Neuropathological Alterations and Cognitive Impairment in a Mouse Model of Vascular Dementia. Molecular Psychiatry, 2020 (PubMed: 33299135) [IF=11.0]

4). Mesenchymal stem cells protect against TBI-induced pyroptosis in vivo and in vitro through TSG-6. Cell Communication and Signaling, 2022 (PubMed: 35982465) [IF=8.4]

5). Physicochemical characterization of polysaccharide from the leaf of Dendrobium officinale and effect on LPS induced damage in GES-1 cell. International Journal of Biological Macromolecules, 2020 (PubMed: 31945440) [IF=8.2]

Application: WB Species: Human Sample: GES-1 cells

Fig. 9. LDOP-1 protects LPS-induced GES-1 damage through inhibiting the TLR4/NF-kb signaling pathway. (A) The protein expressions of cleaved-IL-1β, IL-6, pro-caspase 1 Caspase 1, NF- κB, phospho-NF-κB, TLR4, NLRP3, ASC, phospho-IκBα and IκBα, (B–D) Expression levels of Cleaved-IL-1β, IL-6 and ASC protein were analyzed. (E–G) Protein expression levels ratio of cleaved-caspase-1 to pro-caspase-1, phospho-IκBα to IκBα and, phospho-NF-кB to NF-κB. (H–I) Expression levels of NLRP3 and TLR4 protein were analyzed. The location assay of by laser scanning confocal microscopy. β-Actin was used as control. (J) Expression of IL-6 were observed by fluorescence microscopy, red indicated positive immunofluorescence results for IL-6, blue indicated the result of DAPI. The data were presented as the mean ± SD from three independent experiments (n = 3). Compared to the control group, #p b 0.05, ##p b 0.01; compared to the model group *p b 0.05, **p b 0.01.

6). Cinnamic acid preserves against myocardial ischemia/reperfusion injury via suppression of NLRP3/Caspase-1/GSDMD signaling pathway. Phytomedicine, 2022 (PubMed: 35320770) [IF=7.9]

7). 8-Oxypalmatine, a novel oxidative metabolite of palmatine, exhibits superior anti-colitis effect via regulating Nrf2 and NLRP3 inflammasome. BIOMEDICINE & PHARMACOTHERAPY, 2022 (PubMed: 35779424) [IF=7.5]

8). Oxytocin ameliorates high glucose- and ischemia/reperfusion-induced myocardial injury by suppressing pyroptosis via AMPK signaling pathway. BIOMEDICINE & PHARMACOTHERAPY, 2022 (PubMed: 36076588) [IF=7.5]

9). The Chinese herbal medicine Fufang Zhenzhu Tiaozhi protects against diabetic cardiomyopathy by alleviating cardiac lipotoxicity-induced oxidative stress and NLRP3-dependent inflammasome activation. BIOMEDICINE & PHARMACOTHERAPY, 2022 (PubMed: 35190353) [IF=7.5]

10). Astragaloside IV alleviates PM2.5-caused lung toxicity by inhibiting inflammasome‐mediated pyroptosis via NLRP3/caspase-1 axis inhibition in mice. BIOMEDICINE & PHARMACOTHERAPY, 2022 (PubMed: 35462332) [IF=7.5]

Restrictive clause

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.

Cleaved-Caspase 1 (Ala317), p10 Antibody - #AF4022