Product: Phospho-Caveolin 1 (Tyr14) Antibody
Catalog: AF3386
Description: Rabbit polyclonal antibody to Phospho-Caveolin 1 (Tyr14)
Application: WB IF/ICC
Cited expt.: WB, IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog
Mol.Wt.: 23kDa; 20kD(Calculated).
Uniprot: Q03135
RRID: AB_2834817

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%)
Clonality:
Polyclonal
Specificity:
Phospho-Caveolin 1 (Tyr14) Antibody detects endogenous levels of Caveolin 1 only when phosphorylated at Tyrosine 14.
RRID:
AB_2834817
Cite Format: Affinity Biosciences Cat# AF3386, RRID:AB_2834817.
Conjugate:
Unconjugated.
Purification:
The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

BSCL3; CAV; CAV1; CAV1_HUMAN; caveolae protein, 22 kD; caveolin 1 alpha isoform; caveolin 1 beta isoform; Caveolin 1 caveolae protein 22kDa; Caveolin-1; Caveolin1; cell growth-inhibiting protein 32; CGL3; LCCNS; MSTP085; OTTHUMP00000025031; PPH3; VIP 21; VIP21;

Immunogens

Immunogen:

A synthesized peptide derived from human Caveolin 1 around the phosphorylation site of Tyr14.

Uniprot:
Gene(ID):
Expression:
Q03135 CAV1_HUMAN:

Skeletal muscle, liver, stomach, lung, kidney and heart (at protein level). Expressed in the brain.

Description:
caveolin-1 May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Involved in the costimulatory signal essential for T-cell receptor (TCR)- mediated T-cell activation.
Sequence:
MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Dog
100
Rabbit
100
Chicken
64
Xenopus
0
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

May act as a scaffolding protein within caveolar membranes. Forms a stable heterooligomeric complex with CAV2 that targets to lipid rafts and drives caveolae formation. Mediates the recruitment of CAVIN proteins (CAVIN1/2/3/4) to the caveolae. Interacts directly with G-protein alpha subunits and can functionally regulate their activity (By similarity). Involved in the costimulatory signal essential for T-cell receptor (TCR)-mediated T-cell activation. Its binding to DPP4 induces T-cell proliferation and NF-kappa-B activation in a T-cell receptor/CD3-dependent manner. Recruits CTNNB1 to caveolar membranes and may regulate CTNNB1-mediated signaling through the Wnt pathway (By similarity). Negatively regulates TGFB1-mediated activation of SMAD2/3 by mediating the internalization of TGFBR1 from membrane rafts leading to its subsequent degradation.

PTMs:

Ubiquitinated. Undergo monoubiquitination and multi- and/or polyubiquitination. Monoubiquitination of N-terminal lysines promotes integration in a ternary complex with UBXN6 and VCP which promotes oligomeric CAV1 targeting to lysosomes for degradation.

The initiator methionine for isoform 2 is removed during or just after translation. The new N-terminal amino acid is then N-acetylated.

Phosphorylated at Tyr-14 by ABL1 in response to oxidative stress.

Subcellular Location:

Golgi apparatus membrane>Peripheral membrane protein. Cell membrane>Peripheral membrane protein. Membrane>Caveola>Peripheral membrane protein. Membrane raft. Golgi apparatus>trans-Golgi network.
Note: Colocalized with DPP4 in membrane rafts. Potential hairpin-like structure in the membrane. Membrane protein of caveolae.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Skeletal muscle, liver, stomach, lung, kidney and heart (at protein level). Expressed in the brain.

Family&Domains:

Belongs to the caveolin family.

Research Fields

· Cellular Processes > Transport and catabolism > Endocytosis.   (View pathway)

· Cellular Processes > Cellular community - eukaryotes > Focal adhesion.   (View pathway)

· Human Diseases > Infectious diseases: Bacterial > Bacterial invasion of epithelial cells.

· Human Diseases > Cancers: Overview > Proteoglycans in cancer.

· Human Diseases > Cardiovascular diseases > Viral myocarditis.

References

1). The purified extract of steamed Panax ginseng protects cardiomyocyte from ischemic injury via caveolin-1 phosphorylation-mediating calcium influx. Journal of Ginseng Research, 2023 (PubMed: 38107394) [IF=6.8]

Application: IF/ICC    Species: Rat    Sample:

EPG inhibited apoptosis and decreased STIM via p-caveolin-1 against MI injury in myocardium of rats (n = 4-6/group). (A) TUNEL staining, apoptotic nuclei (green) and DAPI-positive normal nuclei (blue). (B) Immuno-histochemical staining of p-caveolin-1 and STIM1. (C) Apoptotic rate (%). (D, E) Quantitative mean fluorescence intensity (MFI). ###P < 0.001 vs. sham, ∗∗∗P < 0.001 vs. model, & P < 0.05, &&&P < 0.001 vs. EPG.

Application: WB    Species: Rat    Sample:

Fig. 5 P-Caveolin-1/SOCE pathway mediated EPG-induced protection against MI injury in rats (n = 4-6/group). (A) Western blot bands. Quantitative analysis of protein expression (B–F) and mRNA expression (G-J).

2). Irisin alleviates steroid-induced vascular dysfunction by regulating the αVβ5-c-Abl-Caveolin-1 signaling pathway. Biochemical pharmacology, 2025 (PubMed: 40086515) [IF=5.3]

3). Daidzein alleviates osteoporosis by promoting osteogenesis and angiogenesis coupling. PeerJ, 2023 (PubMed: 37868048) [IF=2.3]

Application: WB    Species: Rat    Sample: BMECs

Figure 5: Cav-1 inhibits migration and proliferation of BMECs through suppressing EGFR/AKT/PI3K signaling. (A) BMECs were cultured and treated with different dose of erlotinib (0, 5, 10 µM). Scratch wound healing assay was performed to observe the effect of erlotinib on the migration of BMECs. Scale bar, 100 µm. (B) Quantitative analysis of wound healing rate. (C) Representative images of immunofluorescence staining for Ki67 (green) in BMECs treated with different dose of erlotinib (0, 10 µM). Nuclei were stained with DAPI (blue). White arrows indicate Ki67+ cells. Scale bar, 100 µm. (D) Quantification of the percentage of Ki67+ nuclei among the total nuclei. (E) Representative western blot images for p-AKT, AKT, p-Cav-1, Cav-1, PI3K, and p-PI3K in the BMECs treated with 10 µM erlotinib and GAPDH was used as reference proteins for data normalization. (F) The phosphorylation levels of AKT, Cav-1, PI3K protein were quantified and normalized to their total proteins respectively. (G) Representative images of double immunofluorescence staining for Ki67/EMCN. White arrows indicate Ki67+/EMCN+ cells. Scale bar, 50 µm. (H) Quantitative analysis of Ki67+/EMCN+ cells respectively per area of trabecular bone surface. Data were presented as mean ± SE. *p < 0.05 and **p < 0.01 as determined by one-way ANOVA or two-tailed unpaired t-test.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.