PDGFB Antibody - #AF0240

(6)   (7)  
Product: PDGFB Antibody
Catalog: AF0240
Description: Rabbit polyclonal antibody to PDGFB
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Rabbit
Mol.Wt.: 27kDa,22kDa; 27kD(Calculated).
Uniprot: P01127
RRID: AB_2833415

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MS Report
HPLC Report
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:500-1:3000, IF/ICC 1:100-1:500, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Rabbit(85%)
Clonality:
Polyclonal
Specificity:
PDGFB Antibody detects endogenous levels of total PDGFB.
RRID:
AB_2833415
Cite Format: Affinity Biosciences Cat# AF0240, RRID:AB_2833415.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Becaplermin; PDGF 2; PDGF B chain; PDGF subunit B; PDGF-2; PDGF2; Pdgfb; PDGFB_HUMAN; Platelet derived growth factor 2; Platelet-derived growth factor B chain; Platelet-derived growth factor beta polypeptide; Platelet-derived growth factor subunit B; Proto-oncogene c-Sis; SIS; SSV;

Immunogens

Immunogen:
Uniprot:

P01127(PDGFB_HUMAN) >>Visit HPA database.

Gene(ID):
PDGFB(5155)
Expression:
P01127 PDGFB_HUMAN:

Expressed at high levels in the heart, brain (sustantia nigra), placenta and fetal kidney. Expressed at moderate levels in the brain (hippocampus), skeletal muscle, kidney and lung.

Description:
PDGFB Platelet-derived growth factor is a potent mitogen for cells of mesenchymal origin. Binding of this growth factor to its affinity receptor elicits a variety of cellular responses. It is released by platelets upon wounding and plays an important role in stimulating adjacent cells to grow and thereby heals the wound.
Sequence:
MNRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAELDLNMTRSHSGGELESLARGRRSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVTRSPGGSQEQRAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETLGA

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Rabbit
85
Horse
77
Bovine
77
Sheep
77
Dog
69
Pig
0
Xenopus
0
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P01127 As Substrate

Site PTM Type Enzyme
T190 O-Glycosylation
S196 Phosphorylation

Research Backgrounds

Function:

Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin. Required for normal proliferation and recruitment of pericytes and vascular smooth muscle cells in the central nervous system, skin, lung, heart and placenta. Required for normal blood vessel development, and for normal development of kidney glomeruli. Plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFA (By similarity).

Subcellular Location:

Secreted.
Note: Released by platelets upon wounding.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed at high levels in the heart, brain (sustantia nigra), placenta and fetal kidney. Expressed at moderate levels in the brain (hippocampus), skeletal muscle, kidney and lung.

Subunit Structure:

Antiparallel homodimer; disulfide-linked. Antiparallel heterodimer with PDGFA; disulfide-linked. The PDGFB homodimer interacts with PDGFRA and PDGFRB homodimers, and with heterodimers formed by PDGFRA and PDGFRB. The heterodimer composed of PDGFA and PDGFB interacts with PDGFRB homodimers, and with heterodimers formed by PDGFRA and PDGFRB. Interacts with XLKD1 (By similarity). Interacts with LRP1. Interacts with SORL1 (via the N-terminal ectodomain).

Family&Domains:

Belongs to the PDGF/VEGF growth factor family.

Research Fields

· Cellular Processes > Cellular community - eukaryotes > Focal adhesion.   (View pathway)

· Cellular Processes > Cellular community - eukaryotes > Gap junction.   (View pathway)

· Cellular Processes > Cell motility > Regulation of actin cytoskeleton.   (View pathway)

· Environmental Information Processing > Signal transduction > MAPK signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Ras signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Rap1 signaling pathway.   (View pathway)

· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction.   (View pathway)

· Environmental Information Processing > Signal transduction > Phospholipase D signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Jak-STAT signaling pathway.   (View pathway)

· Human Diseases > Drug resistance: Antineoplastic > EGFR tyrosine kinase inhibitor resistance.

· Human Diseases > Infectious diseases: Viral > HTLV-I infection.

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cancers: Overview > MicroRNAs in cancer.

· Human Diseases > Cancers: Specific types > Renal cell carcinoma.   (View pathway)

· Human Diseases > Cancers: Specific types > Glioma.   (View pathway)

· Human Diseases > Cancers: Specific types > Prostate cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Melanoma.   (View pathway)

· Human Diseases > Cancers: Overview > Choline metabolism in cancer.   (View pathway)

References

1). Soft apoptotic-cell-inspired nanoparticles persistently bind to macrophage membranes and promote anti-inflammatory and pro-healing effects. Acta Biomaterialia, 2021 (PubMed: 34245890) [IF=9.7]

Application: IHC    Species: Rat    Sample: Raw 264.7 cells

Fig. 6. Soft d -PSLs evidently promote chronic wound healing in STZ induced diabetic rats. (a) Representative images of the wound closure process at days 0, 1, 3, 7, and 14. (b) Percentage of remaining wound area expressed as the ratio of remaining wound area to the initial wound area. (c) Representative images of H&E staining (Scale bars = 50 μm) and IHC staining (Scale bars = 20 μm). (d-g) Quantification of CD86, CD206, CD31 and PDGF-BB positive area in IHC images. The proportion of the positive area of each field was quantified using Image J software. n = 6 in each group. ns, no significant difference. ∗∗ P < 0.01; ∗∗∗ P < 0.001.
2). A bioactive xyloglucan polysaccharide hydrogel mechanically enhanced by Pluronic F127 micelles for promoting chronic wound healing. International journal of biological macromolecules, 2024 (PubMed: 39047998) [IF=8.2]
3). Mechanical stretching can modify the papillary dermis pattern and papillary fibroblast characteristics during skin regeneration. Journal of Investigative Dermatology, 2022 (PubMed: 35181299) [IF=6.5]
4). Metformin inhibits pulmonary artery smooth muscle cell proliferation by upregulating p21 via NONRATT015587. 2. International Journal of Molecular Medicine, 2022 (PubMed: 35147202) [IF=5.4]

Application: IHC    Species: Rat    Sample: pulmonary artery tissue

Figure 1 Expression of NONRATT015587.2 and p21 in MCT-induced pulmonary hypertension rats. (A) Assessment of RVSP in MCT-induced PAH rats, controls and following MCT+MET treatment. (B) Changes in the RV/(LV+S) ratio. (C) NONRATT015587.2 gene expression was calculated in each group. (D) The expression of CDKN1A/p21 and PDGFB in pulmonary artery tissue was analyzed by immunohistochemistry staining (scale bars, 100 µm). (E) p21 protein expression was determined via western blotting and subsequently quantified. (F) Fluorescence in situ hybridization was performed to analyze the subcellular location of NONRATT015587.2. In this experiment, 18s was used as the cytoplasmic reference gene and u6 was used as the nuclear reference gene. DAPI was used for nuclear staining (scale bars, 50 µm). Data represent mean ± standard deviation (SD). *P<0.05 and **P<0.01 as indicated (n= ≥3). Con, control; MCT, monocrotaline; MET, metformin; PDGFB, platelet-derived growth factor subunit B; RV/(LV+S), right ventricle/left ventricle plus septum; RVSP, right ventricular systolic pressure.
5). Rnf-213 Knockout Induces Pericyte Reduction and Blood-Brain Barrier Impairment in Mouse. Molecular Neurobiology, 2023 (PubMed: 37438553) [IF=5.1]
6). Lipoxin A4 inhibited the activation of hepatic stellate cells -T6 cells by modulating profibrotic cytokines and NF-κB signaling pathway. PROSTAGLANDINS & OTHER LIPID MEDIATORS, 2020 (PubMed: 31698141) [IF=2.9]

Application: WB    Species: mouse    Sample: HSC-T6 cells

Figure 6.| LXA4 inhibited LPS-activated NF-κB signal pathway in HSC-T6 cells. (a-c) The protein levels of NF-κB P65, P-P65, and I-κBα in HSC-T6 cells were measured by western blot and optical density analysis was shown (n=6). **P < 0.01 compared with control group, ##P < 0.01 compared with LPS group, ΔP < 0.05 and ΔΔP < 0.01 compared with LPS + LXA4 group.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.