uPAR Antibody - #DF12495
| Product: | uPAR Antibody |
| Catalog: | DF12495 |
| Description: | Rabbit polyclonal antibody to uPAR |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Mol.Wt.: | 35-70 kDa; 37kD(Calculated). |
| Uniprot: | Q03405 |
| RRID: | AB_2845300 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12495, RRID:AB_2845300.
Fold/Unfold
CD 87; CD87; CD87 antigen; MO 3; MO3; Monocyte activation antigen Mo3; Plasminogen activator receptor urokinase; Plasminogen activator urokinase receptor; PLAUR; U PAR; u plasminogen activator receptor; U-PAR; u-plasminogen activator receptor form 2; UPA receptor; uPAR; UPAR_HUMAN; Urinary plasminogen activator receptor; URKR; Urokinase plasminogen activator receptor; Urokinase plasminogen activator surface receptor; urokinase-type plasminogen activator (uPA) receptor;
Immunogens
Expressed in neurons of the rolandic area of the brain (at protein level). Expressed in the brain.
- Q03405 UPAR_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT
PTMs - Q03405 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| T30 | Phosphorylation | Uniprot | |
| N74 | N-Glycosylation | Uniprot | |
| N184 | N-Glycosylation | Uniprot | |
| N194 | N-Glycosylation | Uniprot | |
| Y217 | Phosphorylation | Uniprot | |
| N222 | N-Glycosylation | Uniprot | |
| K254 | Ubiquitination | Uniprot | |
| N255 | N-Glycosylation | Uniprot |
Research Backgrounds
Acts as a receptor for urokinase plasminogen activator. Plays a role in localizing and promoting plasmin formation. Mediates the proteolysis-independent signal transduction activation effects of U-PA. It is subject to negative-feedback regulation by U-PA which cleaves it into an inactive form.
Cell membrane. Cell projection>Invadopodium membrane.
Note: Colocalized with FAP (seprase) preferentially at the cell surface of invadopodia membrane in a cytoskeleton-, integrin- and vitronectin-dependent manner.
Cell membrane>Lipid-anchor.
Secreted.
Expressed in neurons of the rolandic area of the brain (at protein level). Expressed in the brain.
Monomer (Probable). Interacts with MRC2. Interacts (via the UPAR/Ly6 domains) with SRPX2. Interacts with FAP (seprase); the interaction occurs at the cell surface of invadopodia membrane. Interacts with SORL1 (via N-terminal ectodomain); this interaction decreases PLAUR internalization. The ternary complex composed of PLAUR-PLAU-SERPINE1 also interacts with SORL1.
Research Fields
· Human Diseases > Cancers: Overview > Proteoglycans in cancer.
· Organismal Systems > Immune system > Complement and coagulation cascades. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.