UBE2E2 Antibody - #DF12493
| Product: | UBE2E2 Antibody |
| Catalog: | DF12493 |
| Description: | Rabbit polyclonal antibody to UBE2E2 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Zebrafish, Chicken, Xenopus |
| Mol.Wt.: | 22 kDa; 22kD(Calculated). |
| Uniprot: | Q96LR5 |
| RRID: | AB_2845298 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12493, RRID:AB_2845298.
Fold/Unfold
FLJ25157; UB2E2_HUMAN; UBC4/5 homolog yeast; UBCH 8; UbcH8; Ube2e2; Ubiquitin carrier protein E2; Ubiquitin conjugating enzyme E2 E2; Ubiquitin conjugating enzyme E2E 2 (homologous to yeast UBC4/5); Ubiquitin conjugating enzyme E2E 2 (UBC4/5 homolog yeast); Ubiquitin conjugating enzyme E2E 2; Ubiquitin protein ligase E2; Ubiquitin-conjugating enzyme E2 E2; Ubiquitin-protein ligase E2;
Immunogens
- Q96LR5 UB2E2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSTEAQRVDDSPSTSGGSSDGDQRESVQQEPEREQVQPKKKEGKISSKTAAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q96LR5 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S2 | Acetylation | Uniprot | |
| T3 | Phosphorylation | Uniprot | |
| S11 | Phosphorylation | Uniprot | |
| S15 | Phosphorylation | Uniprot | |
| S18 | Phosphorylation | Uniprot | |
| S19 | Phosphorylation | Uniprot | |
| K44 | Methylation | Uniprot | |
| K48 | Acetylation | Uniprot | |
| T49 | Phosphorylation | Uniprot | |
| K52 | Methylation | Uniprot | |
| S54 | Phosphorylation | Uniprot | |
| K62 | Ubiquitination | Uniprot | |
| Y85 | Phosphorylation | Uniprot | |
| K144 | Ubiquitination | Uniprot |
Research Backgrounds
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'- and 'Lys-48'-, as well as 'Lys-63'-linked polyubiquitination. Catalyzes the ISGylation of influenza A virus NS1 protein.
Autoubiquitinated in vitro.
Belongs to the ubiquitin-conjugating enzyme family.
Research Fields
· Genetic Information Processing > Folding, sorting and degradation > Ubiquitin mediated proteolysis. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.