SUGT1 Antibody - #DF12481
Product: | SUGT1 Antibody |
Catalog: | DF12481 |
Description: | Rabbit polyclonal antibody to SUGT1 |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Sheep, Chicken |
Mol.Wt.: | 38 kDa and 41 kDa; 41kD(Calculated). |
Uniprot: | Q9Y2Z0 |
RRID: | AB_2845286 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12481, RRID:AB_2845286.
Fold/Unfold
Protein 40 6 3; Protein 40-6-3; Protein SGT1 homolog; Putative 40 6 3 protein; Sgt1; SGT1 suppressor of G2 allele of SKP1; SGT1_HUMAN; SGT1B protein; sugt1; Suppressor of G2 allele of SKP1 homolog; Suppressor of G2 allele of SKP1 S. cerevisiae homolog of;
Immunogens
- Q9Y2Z0 SGT1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAAAAAGTATSQRFFQSFSDALIDEDPQAALEELTKALEQKPDDAQYYCQRAYCHILLGNYCVAVADAKKSLELNPNNSTAMLRKGICEYHEKNYAAALETFTEGQKLDIETGFHRVGQAGLQLLTSSDPPALDSQSAGITGADANFSVWIKRCQEAQNGSESEVWTHQSKIKYDWYQTESQVVITLMIKNVQKNDVNVEFSEKELSALVKLPSGEDYNLKLELLHPIIPEQSTFKVLSTKIEIKLKKPEAVRWEKLEGQGDVPTPKQFVADVKNLYPSSSPYTRNWDKLVGEIKEEEKNEKLEGDAALNRLFQQIYSDGSDEVKRAMNKSFMESGGTVLSTNWSDVGKRKVEINPPDDMEWKKY
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9Y2Z0 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
A2 | Acetylation | Uniprot | |
T8 | Phosphorylation | Uniprot | |
S11 | Phosphorylation | Uniprot | |
S17 | Phosphorylation | Uniprot | |
S19 | Phosphorylation | Uniprot | |
K41 | Ubiquitination | Uniprot | |
Y47 | Phosphorylation | Uniprot | |
Y48 | Phosphorylation | Uniprot | |
C49 | S-Nitrosylation | Uniprot | |
K70 | Ubiquitination | Uniprot | |
K85 | Ubiquitination | Uniprot | |
C88 | S-Nitrosylation | Uniprot | |
K93 | Ubiquitination | Uniprot | |
Y95 | Phosphorylation | Uniprot | |
K171 | Ubiquitination | Uniprot | |
K194 | Ubiquitination | Uniprot | |
K204 | Ubiquitination | Uniprot | |
K211 | Ubiquitination | Uniprot | |
K221 | Ubiquitination | Uniprot | |
K256 | Ubiquitination | Uniprot | |
T265 | Phosphorylation | Uniprot | |
K267 | Ubiquitination | Uniprot | |
K274 | Ubiquitination | Uniprot | |
Y277 | Phosphorylation | Uniprot | |
S279 | Phosphorylation | Uniprot | |
S281 | Phosphorylation | Uniprot | |
Y283 | Phosphorylation | Uniprot | |
T284 | Phosphorylation | Uniprot | |
K289 | Ubiquitination | Uniprot | |
K295 | Sumoylation | Uniprot | |
K299 | Ubiquitination | Uniprot | |
K302 | Ubiquitination | Uniprot | |
Y317 | Phosphorylation | Uniprot | |
S318 | Phosphorylation | Uniprot | |
S321 | Phosphorylation | Uniprot | |
K325 | Ubiquitination | Uniprot | |
K330 | Ubiquitination | Uniprot | |
S331 | Phosphorylation | P53350 (PLK1) | Uniprot |
S335 | Phosphorylation | Uniprot | |
T338 | Phosphorylation | Uniprot | |
S345 | Phosphorylation | Uniprot | |
K349 | Ubiquitination | Uniprot | |
K351 | Ubiquitination | Uniprot | |
Y365 | Phosphorylation | Uniprot |
Research Backgrounds
May play a role in ubiquitination and subsequent proteasomal degradation of target proteins.
Phosphorylated at Ser-281 and Ser-331, dephosphorylation promotes nuclear translocation, most likely due to disruption of the SUGT1-HSP90 complex.
Cytoplasm. Nucleus.
Note: Translocates to the nucleus upon heat shock, requiring S100A6.
Probably associates with SCF (SKP1-CUL1-F-box protein) complex through interaction with SKP1. Interacts with S100A6. Interacts with HSP90.
The CS domain mediates interaction with HSP90.
Belongs to the SGT1 family.
Research Fields
· Organismal Systems > Immune system > NOD-like receptor signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.